Sequences
EST Library Info
nco1Newborn 115 days, colon
Clusters
Oligos
SNPs

Gene ID ENSG00000198449 (click for geneview)
Transcript ID ENST00000354303(link to ensembl)
Symbol XP_372048.1
Localtion Chromosome:8:81633583:81634613:1 band: 8q21.13
Description PREDICTED: similar to 40S ribosomal protein SA (p40) (34/67 kDa laminin receptor) (Colon carcinoma laminin-binding protein) (NEM/1CHD4) (Multidrug resistance-associated protein MGr1-Ag)
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--K--E--E--D--V--L--K--F--L--A--A--G--T--H--L--G--G--T--N--L--D--F--Q--M--E--Q--Y--I--Y--K--R--K--
ATGAAGGAGGAGGATGTCCTTAAGTTCCTTGCAGCAGGAACCCACTTAGGTGGCACCAATCTTGACTTCCAGATGGAACAGTACATCTATAAAAGGAAAA
:::::.::::::::::::::.::::::::::::::::::::::::.: :::::::::::.:::::::::::.:::::::::::::::::.::::::::::
ATGAAAGAGGAGGATGTCCTCAAGTTCCTTGCAGCAGGAACCCACCTTGGTGGCACCAACCTTGACTTCCAAATGGAACAGTACATCTACAAAAGGAAAA
-M--K--E--E--D--V--L--K--F--L--A--A--G--T--H--L--G--G--T--N--L--D--F--Q--M--E--Q--Y--I--Y--K--R--K--

----------------------------------------------------------------------------------------------------
S--D--G--I--Y--I--I--N--L--K--R--T--W--E--K--L--L--L--A--A--R--A--I--V--A--I--E--N--P--A--D--V--S--V
GTGATGGTATCTACATCATAAATCTGAAGAGGACCTGGGAGAAGCTTCTGCTGGCAGCTCGTGCCATTGTTGCCATTGAAAACCCTGCTGATGTCAGTGT
:::::::.:::::::::::::::::::::::.:::::::::::.::::::.::::.:::::::::::.::::::::::::::::: ::.:::::::::::
GTGATGGCATCTACATCATAAATCTGAAGAGAACCTGGGAGAAACTTCTGTTGGCGGCTCGTGCCATCGTTGCCATTGAAAACCCAGCCGATGTCAGTGT
S--D--G--I--Y--I--I--N--L--K--R--T--W--E--K--L--L--L--A--A--R--A--I--V--A--I--E--N--P--A--D--V--S--V

----------------------------------------------------------------------------------------------------
--I--S--S--R--N--T--G--Q--R--A--V--L--K--F--A--A--A--T--G--A--T--P--I--A--G--C--F--T--P--G--T--F--T-
TATATCATCCAGGAATACTGGCCAGAGGGCTGTGCTGAAGTTTGCTGCTGCCACTGGAGCCACTCCAATTGCTGGCTGCTTCACTCCTGGAACTTTCACT
.::::: :::::::::::::::::: :.:::::::::::::::::::::::::::::::::::::: :::::::::.::::::::::::::::.::::::
CATATCCTCCAGGAATACTGGCCAGCGAGCTGTGCTGAAGTTTGCTGCTGCCACTGGAGCCACTCCTATTGCTGGCCGCTTCACTCCTGGAACCTTCACT
--I--S--S--R--N--T--G--Q--R--A--V--L--K--F--A--A--A--T--G--A--T--P--I--A--G--R--F--T--P--G--T--F--T-

----------------------------------------------------------------------------------------------------
-N--Q--I--Q--A--A--F--Q--E--P--R--L--L--V--V--T--D--P--R--A--D--H--Q--P--F--T--E--A--S--Y--V--N--L--
AACCAGATCCAGGCAGCCTTCCAGGAGCCACGACTTCTTGTGGTTACTGACCCCAGGGCTGACCACCAGCCTTTCACGGAGGCATCTTATGTTAACCTAC
::::::::::::::::::::::.::::::: ::::::: :::::::::::.:::::::::::::::::::::.::::.::::: ::::::::::::::.:
AACCAGATCCAGGCAGCCTTCCGGGAGCCAAGACTTCTGGTGGTTACTGATCCCAGGGCTGACCACCAGCCTCTCACAGAGGCCTCTTATGTTAACCTGC
-N--Q--I--Q--A--A--F--R--E--P--R--L--L--V--V--T--D--P--R--A--D--H--Q--P--L--T--E--A--S--Y--V--N--L--

----------------------------------------------------------------------------------------------------
P--T--I--A--L--C--N--T--D--S--P--L--R--Y--V--H--I--A--I--P--C--N-----N--K--G--A--H--S--V--G--L--M--W
CTACCATTGCTCTGTGTAACACAGATTCTCCTCTGCGCTATGTGCACATTGCCATCCCATGCAAC---AACAAGGGAGCTCACTCAGTGGGTTTGATGTG
:::::::::::::::::::::::::.:: ::::::::.:::::: :::::::::::::.::::::   ::::::::::::::::::::::::.:::::::
CTACCATTGCTCTGTGTAACACAGACTCACCTCTGCGTTATGTGGACATTGCCATCCCGTGCAACA--AACAAGGGAGCTCACTCAGTGGGTCTGATGTG
P--T--I--A--L--C--N--T--D--S--P--L--R--Y--V--D--I--A--I--P--C--N--\--N--K--G--A--H--S--V--G--L--M--W

----------------------------------------------------------------------------------------------------
--W--M--L--A--W--E--V--L--C--M--R--G--T--I--S--R--E--H--P--W--E--V--M--P--D--F--C--F--Y--R--D--P--E-
GTGGATGCTGGCTTGGGAAGTTCTGTGCATGCGTGGCACCATTTCCCGTGAACACCCGTGGGAGGTCATGCCTGATTTCTGCTTCTACAGAGATCCTGAA
::::::::: ::..:::::                                                                                 
GTGGATGCTCGCCCGGGAA---------------------------------------------------------------------------------
--W--M--L--A--R--E----------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-E--I--E--K--E--E--Q--P--A--A--E--K--A--V--T--K--E--E--F--Q--G--E--R--T--A--P--A--P--E--F--T--A--T--
GAGATTGAAAAAGAAGAGCAGCCTGCTGCTGAAAAGGCTGTGACCAAGGAGGAATTTCAGGGTGAAAGGACTGCTCCAGCTCCTGAGTTCACTGCTACTC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
Q--P--E--V--A--D--W--S--E--G--V--Q--V--P--S--V--P--I--Q--Q--F--P--T--E--D--C--S--A--Q--P--A--T--E--D
AGCCTGAGGTTGCAGACTGGTCTGAAGGTGTGCAGGTGCCCTCTGTGCCTATTCAGCAGTTCCCTACTGAAGACTGCAGCGCTCAGCCTGCCACGGAAGA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

--------------------------------------------------------------->
--W--S--A--A--P--T--A--Q--A--T--E--W--V--G--A--T--T--E--W--S--*-
CTGGTCTGCAGCTCCCACTGCCCAGGCCACTGAATGGGTAGGAGCAACCACTGAATGGTCTTAA
                                                                
----------------------------------------------------------------
----------------------------------------------------------------

Pig Consensus Sequence

>BGISUST0000876298
ATGAAAGAGGAGGATGTCCTCAAGTTCCTTGCAGCAGGAACCCACCTTGGTGGCACCAACCTTGACTTCCAAATGGAACAGTACATCTACAAAAGGAAAA
GTGATGGCATCTACATCATAAATCTGAAGAGAACCTGGGAGAAACTTCTGTTGGCGGCTCGTGCCATCGTTGCCATTGAAAACCCAGCCGATGTCAGTGT
CATATCCTCCAGGAATACTGGCCAGCGAGCTGTGCTGAAGTTTGCTGCTGCCACTGGAGCCACTCCTATTGCTGGCCGCTTCACTCCTGGAACCTTCACT
AACCAGATCCAGGCAGCCTTCCGGGAGCCAAGACTTCTGGTGGTTACTGATCCCAGGGCTGACCACCAGCCTCTCACAGAGGCCTCTTATGTTAACCTGC
CTACCATTGCTCTGTGTAACACAGACTCACCTCTGCGTTATGTGGACATTGCCATCCCGTGCAAcaACAAGGGAGCTCACTCAGTGGGTCTGATGTGGTG
GATGCTCGCCCGGGAA------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
-------------------------------------------------------------


>BGISUSP0000876298
MKEEDVLKFLAAGTHLGGTNLDFQMEQYIYKRKSDGIYIINLKRTWEKLLLAARAIVAIENPADVSVISSRNTGQRAVLKFAAATGATPIAGRFTPGTFT
NQIQAAFREPRLLVVTDPRADHQPLTEASYVNLPTIALCNTDSPLRYVDIAIPCNNKGAHSVGLMWWMLARE----------------------------
---------------------------------------------------------------------------------------