Sequences
EST Library Info
jca2Joint capsule
Clusters
Oligos
SNPs

Gene ID ENSG00000168079 (click for geneview)
Transcript ID ENST00000354914(link to ensembl)
Symbol NP_776194.2
Localtion Chromosome:8:27783672:27906117:-1 band: 8p21.1
Description hypothetical protein MGC45780
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--E--N--K--A--M--Y--L--H--T--V--S--D--C--D--T--S--S--I--C--E--D--S--F--D--G--R--S--L--S--K--L--N--
ATGGAGAACAAAGCTATGTACCTACACACCGTCAGCGACTGTGACACCAGCTCCATCTGTGAGGATTCCTTTGATGGCAGGAGCCTGTCCAAGCTGAACC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-----------><---------------------------------------------------------------------------------------
L--C--E--D--G--P--C--H--K--R--R--A--S--I--C--C--T--Q--L--G--S--L--S--A--L--K--H--A--V--L--G--L--Y--L
TGTGTGAGGATGGTCCATGTCACAAACGGCGGGCAAGCATCTGCTGTACCCAGCTGGGGTCCCTGTCGGCCCTGAAGCATGCTGTCCTGGGGCTCTACCT
              ::.::.::::::::.::::: .::. ::::::.:::::.::::: :: :::::::::::::::::::: ::.:: :::::::::::
--------------CCGTGCCACAAACGACGGGCTGGCGGCTGCTGCACCCAACTGGGCTCACTGTCGGCCCTGAAGCATGCGGTTCTTGGGCTCTACCT
---------------P--C--H--K--R--R--A--G--G--C--C--T--Q--L--G--S--L--S--A--L--K--H--A--V--L--G--L--Y--L

----------------------------------------><----------------------------------------------------------
--L--V--F--L--I--L--V--G--I--F--I--L--A--V--S--R--P--R--S--S--P--D--D--L--K--A--L--T--R--N--V--N--R-
GCTGGTCTTCCTGATTCTTGTGGGCATCTTCATCTTAGCAGTGTCCAGGCCGCGCAGCTCCCCTGACGACCTGAAGGCCCTGACTCGCAATGTGAACCGG
::::::::::::::::::::::::::::::::::::::::   :::::::: :: :::::::: :::::::::::::: :::::::: ::.:::::::::
GCTGGTCTTCCTGATTCTTGTGGGCATCTTCATCTTAGCA---TCCAGGCCCCGGAGCTCCCCGGACGACCTGAAGGCGCTGACTCGGAACGTGAACCGG
--L--V--F--L--I--L--V--G--I--F--I--L--A-----S--R--P--R--S--S--P--D--D--L--K--A--L--T--R--N--V--N--R-

----------------------------------------------------------------------------------------------------
-L--N--E--S--F--R--D--L--Q--L--R--L--L--Q--A--P--L--Q--A--D--L--T--E--Q--V--W--K--V--Q--D--A--L--Q--
CTGAATGAGAGCTTCCGGGACTTGCAGCTGCGGCTGCTGCAGGCTCCGCTGCAAGCGGACCTGACGGAGCAGGTGTGGAAGGTGCAGGACGCGCTGCAGA
:::::.::::::::::::::.:::::::::::::::.:.::::: :::.::::.::::: :::.  ::::::::::::::::.:::::::::::::::::
CTGAACGAGAGCTTCCGGGATTTGCAGCTGCGGCTGTTACAGGCGCCGTTGCAGGCGGAGCTGGGCGAGCAGGTGTGGAAGGCGCAGGACGCGCTGCAGA
-L--N--E--S--F--R--D--L--Q--L--R--L--L--Q--A--P--L--Q--A--E--L--G--E--Q--V--W--K--A--Q--D--A--L--Q--

----------------------------------------------------------------------------------------------------
N--Q--S--D--S--L--L--A--L--A--G--A--V--Q--R--L--E--G--A--L--W--G--L--Q--A--Q--A--V--Q--T--E--Q--A--V
ACCAGTCAGACTCGTTGCTGGCGCTGGCGGGCGCAGTGCAGCGGCTGGAGGGCGCGCTGTGGGGGCTGCAGGCGCAGGCGGTGCAGACCGAGCAGGCGGT
:::::::.::::::.::: :::::::::.:::::.::::::::::::::::::::::::::::::::::::::::::::::. :::: .:::::::: ::
ACCAGTCGGACTCGCTGCAGGCGCTGGCAGGCGCGGTGCAGCGGCTGGAGGGCGCGCTGTGGGGGCTGCAGGCGCAGGCGGCTCAGAGTGAGCAGGCCGT
N--Q--S--D--S--L--Q--A--L--A--G--A--V--Q--R--L--E--G--A--L--W--G--L--Q--A--Q--A--A--Q--S--E--Q--A--V

----------------------------------------------------------------------------------------------------
--A--L--L--R--D--R--T--G--Q--Q--S--D--T--A--Q--L--E--L--Y--Q--L--Q--V--E--S--N--S--S--Q--L--L--L--R-
GGCCCTGCTGCGGGACCGCACGGGCCAGCAGAGCGACACGGCGCAGCTGGAGCTCTACCAGCTGCAGGTGGAGAGCAACAGTAGCCAGCTGCTGCTGAGG
:::::::.:::: ::::::::::::::::::::::::.:::::::::::::::::::.::::: :::::.::::::::: :.::.:::::::: .:: ::
GGCCCTGTTGCGCGACCGCACGGGCCAGCAGAGCGACGCGGCGCAGCTGGAGCTCTATCAGCTCCAGGTAGAGAGCAACCGCAGTCAGCTGCTCTTGCGG
--A--L--L--R--D--R--T--G--Q--Q--S--D--A--A--Q--L--E--L--Y--Q--L--Q--V--E--S--N--R--S--Q--L--L--L--R-

----------------------------------------------------------------------------------------------------
-R--H--A--G--L--L--D--G--L--A--R--R--V--G--I--L--G--E--E--L--A--D--V--G--G--V--L--R--G--L--N--H--S--
CGCCACGCGGGCCTGCTGGACGGGCTGGCGCGCAGGGTGGGCATCCTGGGCGAGGAGCTGGCCGACGTGGGCGGCGTGCTGCGCGGCCTCAACCACAGCC
:::::::: ::::::::::::::::::::.::: ::::::::                                                          
CGCCACGCCGGCCTGCTGGACGGGCTGGCACGCCGGGTGGGC----------------------------------------------------------
-R--H--A--G--L--L--D--G--L--A--R--R--V--G-----------------------------------------------------------

----------------------------------------------------------------------------------------------------
L--S--Y--D--V--A--L--H--R--T--R--L--Q--D--L--R--V--L--V--S--N--A--S--E--D--T--R--R--L--R--L--A--H--V
TGTCCTACGACGTGGCCCTCCACCGCACGCGGCTGCAGGACCTGCGGGTGCTGGTGAGCAACGCCAGCGAGGACACGCGCCGCCTGCGCCTGGCGCACGT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--G--M--E--L--Q--L--K--Q--E--L--A--M--L--N--A--V--T--E--D--L--R--L--K--D--W--E--H--S--I--A--L--R--N-
AGGCATGGAGCTGCAGCTGAAGCAGGAGCTGGCCATGCTCAACGCGGTCACCGAGGACCTGCGCCTCAAGGACTGGGAGCACTCCATCGCACTGCGGAAC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

---------------><-------------------------------------------------------------------------------><--
-I--S--L--A--K--G--P--P--G--P--K--G--D--Q--G--D--E--G--K--E--G--R--P--G--I--P--G--L--P--G--L--R--G--
ATCTCCCTCGCGAAAGGGCCACCGGGACCCAAAGGTGATCAGGGGGATGAAGGAAAGGAAGGCAGGCCTGGCATCCCTGGATTGCCTGGACTTCGAGGTC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-----------------------------------------------------------------------------------------------><---
L--P--G--E--R--G--T--P--G--L--P--G--P--K--G--D--D--G--K--L--G--A--T--G--P--M--G--M--R--G--F--K--G--D
TGCCCGGGGAGAGAGGTACCCCAGGATTGCCCGGGCCCAAGGGCGATGATGGGAAGCTGGGGGCCACAGGACCAATGGGCATGCGTGGGTTCAAAGGTGA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------><----------------------------------------------
--R--G--P--K--G--E--K--G--E--K--G--D--R--A--G--D--A--S--G--V--E--A--P--M--M--I--R--L--V--N--G--S--G-
CCGAGGCCCAAAAGGAGAGAAAGGAGAGAAAGGAGACAGAGCTGGGGATGCCAGTGGCGTGGAGGCCCCGATGATGATCCGCCTGGTGAATGGCTCAGGT
                                                                         :::.:::: :::::::::::: :.::.
-------------------------------------------------------------------------ATGGTCCGGCTGGTGAATGGCACGGGC
--------------------------------------------------------------------------M--V--R--L--V--N--G--T--G-

----------------------------------------------------------------------------------------------------
-P--H--E--G--R--V--E--V--Y--H--D--R--R--W--G--T--V--C--D--D--G--W--D--K--K--D--G--D--V--V--C--R--M--
CCGCACGAGGGCCGCGTGGAAGTGTACCACGACCGGCGTTGGGGCACCGTGTGTGACGACGGCTGGGACAAGAAGGACGGAGACGTGGTGTGCCGCATGC
::.::: :: ::::::::::.::::::::.::::::::.::::::::::::::::::::.::::::::::::::::::::.::.::::::::::::::::
CCACACCAGTGCCGCGTGGAGGTGTACCATGACCGGCGCTGGGGCACCGTGTGTGACGATGGCTGGGACAAGAAGGACGGGGATGTGGTGTGCCGCATGC
-P--H--Q--C--R--V--E--V--Y--H--D--R--R--W--G--T--V--C--D--D--G--W--D--K--K--D--G--D--V--V--C--R--M--

--------------------------------------------------><------------------------------------------------
L--G--F--R--G--V--E--E--V--Y--R--T--A--R--F--G--Q--G--T--G--R--I--W--M--D--D--V--A--C--K--G--T--E--E
TCGGCTTCCGCGGTGTGGAGGAGGTGTACCGCACAGCTCGATTCGGGCAAGGCACTGGGAGGATCTGGATGGATGACGTTGCCTGCAAGGGCACAGAGGA
: ::::::: :.:.:. ::::: :::.:::: ::.::::. :::::.:::   :: :::::.::.:::::::::::.:::::::::::::::::::::::
TGGGCTTCCCCAGCGCCGAGGACGTGCACCGGACGGCTCACTTCGGACAA---ACAGGGAGAATTTGGATGGATGATGTTGCCTGCAAGGGCACAGAGGA
L--G--F--P--S--A--E--D--V--H--R--T--A--H--F--G--Q-----T--G--R--I--W--M--D--D--V--A--C--K--G--T--E--E

--------------------------------------------------------------------------------------->
--T--I--F--R--C--S--F--S--K--W--G--V--T--N--C--G--H--A--E--D--A--S--V--T--C--N--R--H--*-
AACCATCTTCCGCTGCAGCTTCTCCAAATGGGGGGTGACAAACTGTGGACATGCCGAAGATGCCAGCGTGACATGCAACAGACACTGA
:::::::::::::::::::::::::::::::::::::::::::::.:: ::.:::::.:::::..: ::::::::::: :::::::::
AACCATCTTCCGCTGCAGCTTCTCCAAATGGGGGGTGACAAACTGCGGCCACGCCGAGGATGCTGGAGTGACATGCAAGAGACACTGA
--T--I--F--R--C--S--F--S--K--W--G--V--T--N--C--G--H--A--E--D--A--G--V--T--C--K--R--H--*-

Pig Consensus Sequence

>BGISUST0000877191
----------------------------------------------------------------------------------------------------
--------------CCGTGCCACAAACGACGGGCTGGCGGCTGCTGCACCCAACTGGGCTCACTGTCGGCCCTGAAGCATGCGGTTCTTGGGCTCTACCT
GCTGGTCTTCCTGATTCTTGTGGGCATCTTCATCTTAGCA---TCCAGGCCCCGGAGCTCCCCGGACGACCTGAAGGCGCTGACTCGGAACGTGAACCGG
CTGAACGAGAGCTTCCGGGATTTGCAGCTGCGGCTGTTACAGGCGCCGTTGCAGGCGGAGCTGGGCGAGCAGGTGTGGAAGGCGCAGGACGCGCTGCAGA
ACCAGTCGGACTCGCTGCAGGCGCTGGCAGGCGCGGTGCAGCGGCTGGAGGGCGCGCTGTGGGGGCTGCAGGCGCAGGCGGCTCAGAGTGAGCAGGCCGT
GGCCCTGTTGCGCGACCGCACGGGCCAGCAGAGCGACGCGGCGCAGCTGGAGCTCTATCAGCTCCAGGTAGAGAGCAACCGCAGTCAGCTGCTCTTGCGG
CGCCACGCCGGCCTGCTGGACGGGCTGGCACGCCGGGTGGGC----------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
-------------------------------------------------------------------------ATGGTCCGGCTGGTGAATGGCACGGGC
CCACACCAGTGCCGCGTGGAGGTGTACCATGACCGGCGCTGGGGCACCGTGTGTGACGATGGCTGGGACAAGAAGGACGGGGATGTGGTGTGCCGCATGC
TGGGCTTCCCCAGCGCCGAGGACGTGCACCGGACGGCTCACTTCGGACAA---ACAGGGAGAATTTGGATGGATGATGTTGCCTGCAAGGGCACAGAGGA
AACCATCTTCCGCTGCAGCTTCTCCAAATGGGGGGTGACAAACTGCGGCCACGCCGAGGATGCTGGAGTGACATGCAAGAGACACTGA


>BGISUSP0000877191
--------------------------------------PCHKRRAGGCCTQLGSLSALKHAVLGLYLLVFLILVGIFILA-SRPRSSPDDLKALTRNVNR
LNESFRDLQLRLLQAPLQAELGEQVWKAQDALQNQSDSLQALAGAVQRLEGALWGLQAQAAQSEQAVALLRDRTGQQSDAAQLELYQLQVESNRSQLLLR
RHAGLLDGLARRVG--------------------------------------------------------------------------------------
-------------------------------------------------------------------------------------------MVRLVNGTG
PHQCRVEVYHDRRWGTVCDDGWDKKDGDVVCRMLGFPSAEDVHRTAHFGQ-TGRIWMDDVACKGTEETIFRCSFSKWGVTNCGHAEDAGVTCKRH*