Sequences
EST Library Info
csp1Spleen - RNA from China
pgl1Pituitary gland
Clusters
Oligos
SNPs

Gene ID ENSG00000160593 (click for geneview)
Transcript ID ENST00000356289(link to ensembl)
Symbol AMICA1
Localtion Chromosome:11:117569891:117600920:-1 band: 11q23.3
Description adhesion molecule, interacts with CXADR antigen 1 [Source:RefSeq_peptide;Acc:NP_694938]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<-----------------------------------------><--------------------------------------------------------
-M--F--C--P--L--K--L--I--L--L--P--V--L--L--D--Y--S--L--G--L--N--D--L--N--V--S--P--P--E--L--T--V--H--
ATGTTTTGCCCACTGAAACTCATCCTGCTGCCAGTGTTACTGGATTATTCCTTGGGCCTGAATGACTTGAATGTTTCCCCGCCTGAGCTAACAGTCCATG
:::::::.:::::::::: :::::::: ::::::::::::::   ::::::::::::::::::::::::: :::::::.:  . :::::.::::::::.:
ATGTTTTACCCACTGAAAATCATCCTGATGCCAGTGTTACTG---TATTCCTTGGGCCTGAATGACTTGACTGTTTCCTCTGTGGAGCTGACAGTCCACG
-M--F--Y--P--L--K--I--I--L--M--P--V--L--L-----Y--S--L--G--L--N--D--L--T--V--S--S--V--E--L--T--V--H--

-------------------------------------------------------------------------------------------------><-
V--G--D--S--A--L--M--G--C--V--F--Q--S--T--E--D--K--C--I--F--K--I--D--W--T--L--S--P--G--E--H--A--K--D
TGGGTGATTCAGCTCTGATGGGATGTGTTTTCCAGAGCACAGAAGACAAATGTATATTCAAGATAGACTGGACTCTGTCACCAGGAGAGCACGCCAAGGA
:::::::::::::..:::::::::::::.::::.:::::::::::: :::.::.:. . :::.:.:::::::. .: :::.:::::.:::::..: ::::
TGGGTGATTCAGCCTTGATGGGATGTGTCTTCCGGAGCACAGAAGAGAAACGTGTGACAAAGGTGGACTGGATGTTCTCATCAGGAAAGCACATCCAGGA
V--G--D--S--A--L--M--G--C--V--F--R--S--T--E--E--K--R--V--T--K--V--D--W--M--F--S--S--G--K--H--I--Q--D

----------------------------------------------------------------------------------------------------
--E--Y--V--L--Y--Y--Y--S--N--L--S--V--P--I--G--R--F--Q--N--R--V--H--L--M--G--D--I--L--C--N--D--G--S-
CGAATATGTGCTATACTATTACTCCAATCTCAGTGTGCCTATTGGGCGCTTCCAGAACCGCGTACACTTGATGGGGGACATCTTATGCAATGATGGCTCT
.:: ::::::::.: :.::::. ::::. ::::.::::::.: ::::::::::::::.::.::.::::::.::::::::::::::..: :::::::.:::
TGATTATGTGCTGTTCCATTATGCCAACATCAGCGTGCCTGTGGGGCGCTTCCAGAATCGTGTGCACTTGGTGGGGGACATCTTACACCATGATGGTTCT
--D--Y--V--L--F--H--Y--A--N--I--S--V--P--V--G--R--F--Q--N--R--V--H--L--V--G--D--I--L--H--H--D--G--S-

----------------------------------------------------------------------------------------------------
-L--L--L--Q--D--V--Q--E--A--D--Q--G--T--Y--I--C--E--I--R--L--K--G--E--S--Q--V--F--K--K--A--V--V--L--
CTCCTGCTCCAAGATGTGCAAGAGGCTGACCAGGGAACCTATATCTGTGAAATCCGCCTCAAAGGGGAGAGCCAGGTGTTCAAGAAGGCGGTGGTACTGC
::::::::::::.::::: ::::.::::::::::::: :::::.:::::::::::::.:: ::. :::::::: :::::::::.::.::.:::::.::::
CTCCTGCTCCAAAATGTGGAAGAAGCTGACCAGGGAAACTATACCTGTGAAATCCGCTTCCAAATGGAGAGCCTGGTGTTCAAAAAAGCAGTGGTGCTGC
-L--L--L--Q--N--V--E--E--A--D--Q--G--N--Y--T--C--E--I--R--F--Q--M--E--S--L--V--F--K--K--A--V--V--L--

-----------------------><---------------------------------------------------------------------------
H--V--L--P--E--E--P--K--E--L--M--V--H--V--G--G--L--I--Q--M--G--C--V--F--Q--S--T--E--V--K--H--V--T--K
ATGTGCTTCCAGAGGAGCCCAAAGAGCTCATGGTCCATGTGGGTGGATTGATTCAGATGGGATGTGTTTTCCAGAGCACAGAAGTGAAACACGTGACCAA
::::.:: ::::::::.::::::   ::::::::.:: :::::::. :.:::. :::::::::::::::::::::::::::::: :::.::.:::::::.
ATGTACTACCAGAGGAACCCAAA---CTCATGGTTCAGGTGGGTGATTCGATCAAGATGGGATGTGTTTTCCAGAGCACAGAAGAGAAGCATGTGACCAG
H--V--L--P--E--E--P--K-----L--M--V--Q--V--G--D--S--I--K--M--G--C--V--F--Q--S--T--E--E--K--H--V--T--R

---------------------------------><-----------------------------------------------------------------
--V--E--W--I--F--S--G--R--R--A--K--E--E--I--V--F--R--Y--Y--H--K--L--R--M--S--V--E--Y--S--Q--S--W--G-
GGTAGAATGGATATTTTCAGGACGGCGCGCAAAGGAGGAGATTGTATTTCGTTACTACCACAAACTCAGGATGTCTGTGGAGTACTCCCAGAGCTGGGGC
:.::::::::::.::.:::               :::::::::::.:: . .::. ::: ::::::::. .::.:..:::.:: :.:.:.::.:::::.:
GATAGAATGGATGTTCTCA---------------GAGGAGATTGTGTTGTCCTATGACCCCAAACTCAACGTGCCCATGGGGTCCCCTCGGAACTGGGAC
--I--E--W--M--F--S-----------------E--E--I--V--L--S--Y--D--P--K--L--N--V--P--M--G--S--P--R--N--W--D-

----------------------------------------------------------------------------------------------------
-H--F--Q--N--R--V--N--L--V--G--D--I--F--R--N--D--G--S--I--M--L--Q--G--V--R--E--S--D--G--G--N--Y--T--
CACTTCCAGAATCGTGTGAACCTGGTGGGGGACATTTTCCGCAATGACGGTTCCATCATGCTTCAAGGAGTGAGGGAGTCAGATGGAGGAAACTACACCT
:.::::::.::.::::::::::::::::: :::::::.:::::::::.::.:::::.:::::.:.:.::::::.:.:::: ::::::::::.:::.::::
CGCTTCCAAAACCGTGTGAACCTGGTGGGCGACATTTCCCGCAATGATGGCTCCATTATGCTCCGAAGAGTGAAGAAGTCTGATGGAGGAAGCTATACCT
-R--F--Q--N--R--V--N--L--V--G--D--I--S--R--N--D--G--S--I--M--L--R--R--V--K--K--S--D--G--G--S--Y--T--

-----------------------------------------------------------------------><---------------------------
C--S--I--H--L--G--N--L--V--F--K--K--T--I--V--L--H--V--S--P--E--E--P--R--T--L--V--T--P--A--A--L--R--P
GCAGTATCCACCTAGGGAACCTGGTGTTCAAGAAAACCATTGTGCTGCATGTCAGCCCGGAAGAGCCTCGAACACTGGTGACCCCGGCAGCCCTGAGGCC
:::::::::::::.:::::::::...::::.:::.:::::::::::::::                                                  
GCAGTATCCACCTGGGGAACCTGACATTCAGGAAGACCATTGTGCTGCAT--------------------------------------------------
C--S--I--H--L--G--N--L--T--F--R--K--T--I--V--L--H---------------------------------------------------

----------------------------------------------------------------------------------------------------
--L--V--L--G--G--N--Q--L--V--I--I--V--G--I--V--C--A--T--I--L--L--L--P--V--L--I--L--I--V--K--K--T--C-
TCTGGTCTTGGGTGGTAATCAGTTGGTGATCATTGTGGGAATTGTCTGTGCCACAATCCTGCTGCTCCCTGTTCTGATATTGATCGTGAAGAAGACCTGT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------><----------------------------------------------------------------------------------------
-G--N--K--S--S--V--N--S--T--V--L--V--K--N--T--K--K--T--N--P--E--I--K--E--K--P--C--H--F--E--R--C--E--
GGAAATAAGAGTTCAGTGAATTCTACAGTCTTGGTGAAGAACACGAAGAAGACTAATCCAGAGATAAAAGAAAAACCCTGCCATTTTGAAAGATGTGAAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----><-------------------------------------------------------------------------------------><-------
G--E--K--H--I--Y--S--P--I--I--V--R--E--V--I--E--E--E--E--P--S--E--K--S--E--A--T--Y--M--T--M--H--P--V
GGGAGAAACACATTTACTCCCCAATAATTGTACGGGAGGTGATCGAGGAAGAAGAACCAAGTGAAAAATCAGAGGCCACCTACATGACCATGCACCCAGT
     :::::.::.::::::.::::::....::..:: :::::::: :::: ::::.::.:::..::::::::.::::::::::::::::::::::::::
-----AAACATATCTACTCCTCAATAACCACACAAGACGTGATCGACGAAGCAGAATCAGGTGGGAAATCAGAAGCCACCTACATGACCATGCACCCAGT
------K--H--I--Y--S--S--I--T--T--Q--D--V--I--D--E--A--E--S--G--G--K--S--E--A--T--Y--M--T--M--H--P--V

------------------------------------------------------------------------------------>
--W--P--S--L--R--S--D--R--N--N--S--L--E--K--K--S--G--G--G--M--P--K--T--Q--Q--A--F--*-
TTGGCCTTCTCTGAGGTCAGATCGGAACAACTCACTTGAAAAAAAGTCAGGTGGGGGAATGCCAAAAACACAGCAAGCCTTTTGA
:::::::::.::::::::::  : ...::.:.::::::: :.:::::::: ::::::::::::::::::  :::: :::::::::
TTGGCCTTCCCTGAGGTCAGCACCAGGCAGCCCACTTGACAGAAAGTCAGCTGGGGGAATGCCAAAAACTGAGCACGCCTTTTGA
--W--P--S--L--R--S--A--P--G--S--P--L--D--R--K--S--A--G--G--M--P--K--T--E--H--A--F--*-

Pig Consensus Sequence

>BGISUST0000891185
ATGTTTTACCCACTGAAAATCATCCTGATGCCAGTGTTACTG---TATTCCTTGGGCCTGAATGACTTGACTGTTTCCTCTGTGGAGCTGACAGTCCACG
TGGGTGATTCAGCCTTGATGGGATGTGTCTTCCGGAGCACAGAAGAGAAACGTGTGACAAAGGTGGACTGGATGTTCTCATCAGGAAAGCACATCCAGGA
TGATTATGTGCTGTTCCATTATGCCAACATCAGCGTGCCTGTGGGGCGCTTCCAGAATCGTGTGCACTTGGTGGGGGACATCTTACACCATGATGGTTCT
CTCCTGCTCCAAAATGTGGAAGAAGCTGACCAGGGAAACTATACCTGTGAAATCCGCTTCCAAATGGAGAGCCTGGTGTTCAAAAAAGCAGTGGTGCTGC
ATGTACTACCAGAGGAACCCAAA---CTCATGGTTCAGGTGGGTGATTCGATCAAGATGGGATGTGTTTTCCAGAGCACAGAAGAGAAGCATGTGACCAG
GATAGAATGGATGTTCTCA---------------GAGGAGATTGTGTTGTCCTATGACCCCAAACTCAACGTGCCCATGGGGTCCCCTCGGAACTGGGAC
CGCTTCCAAAACCGTGTGAACCTGGTGGGCGACATTTCCCGCAATGATGGCTCCATTATGCTCCGAAGAGTGAAGAAGTCTGATGGAGGAAGCTATACCT
GCAGTATCCACCTGGGGAACCTGACATTCAGGAAGACCATTGTGCTGCAT--------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
-----AAACATATCTACTCCTCAATAACCACACAAGACGTGATCGACGAAGCAGAATCAGGTGGGAAATCAGAAGCCACCTACATGACCATGCACCCAGT
TTGGCCTTCCCTGAGGTCAGCACCAGGCAGCCCACTTGACAGAAAGTCAGCTGGGGGAATGCCAAAAACTGAGCACGCCTTTTGA


>BGISUSP0000891185
MFYPLKIILMPVLL-YSLGLNDLTVSSVELTVHVGDSALMGCVFRSTEEKRVTKVDWMFSSGKHIQDDYVLFHYANISVPVGRFQNRVHLVGDILHHDGS
LLLQNVEEADQGNYTCEIRFQMESLVFKKAVVLHVLPEEPK-LMVQVGDSIKMGCVFQSTEEKHVTRIEWMFS-----EEIVLSYDPKLNVPMGSPRNWD
RFQNRVNLVGDISRNDGSIMLRRVKKSDGGSYTCSIHLGNLTFRKTIVLH--------------------------------------------------
-----------------------------------KHIYSSITTQDVIDEAESGGKSEATYMTMHPVWPSLRSAPGSPLDRKSAGGMPKTEHAF*