Sequences
EST Library Info
cst2Stomach - RNA from China
ecc2Foetus 50 days, cortex cerebri
nlu1Newborn 115 days, lung
Clusters
Oligos
SNPs

Gene ID ENSG00000119866 (click for geneview)
Transcript ID ENST00000356326(link to ensembl)
Symbol BCL11A
Localtion Chromosome:2:60595978:60692189:-1 band: 2p16.1
Description B-cell lymphoma/leukemia 11A (B-cell CLL/lymphoma 11A) (COUP-TF interacting protein 1) (Ecotropic viral integration site 9 protein) (EVI-9). [Source:Uniprot/SWISSPROT;Acc:Q9H165]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<-------------------------------------------------------------------------------------><------------
-M--S--K--G--T--D--E--D--I--F--S--G--V--S--F--F--L--T--R--L--S--R--C--E--P--S--R--R--P--P--A--P--Q--
ATGTCAAAAGGCACTGATGAAGATATTTTCTCTGGAGTCTCCTTCTTTCTAACCCGGCTCTCCCGATGTGAACCGAGCCGTCGTCCGCCCGCCCCGCAGC
      ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
------AAAGGCACTGATGAAGATATTTTCTCTGGAGTCTCCTTCTTTCTAACCCGGCTCTCCCGATGTGAACCGAGCCGTCGTCCGCCCGCCCCGCAGC
-------K--G--T--D--E--D--I--F--S--G--V--S--F--F--L--T--R--L--S--R--C--E--P--S--R--R--P--P--A--P--Q--

-----------------------------------------------------------><---------------------------------------
P--T--M--S--R--R--K--Q--G--K--P--Q--H--L--S--K--R--E--F--S--P--E--P--L--E--A--I--L--T--D--D--E--P--D
CCACCATGTCTCGCCGCAAGCAAGGCAAACCCCAGCACTTAAGCAAACGGGAATTCTCGCCCGAGCCTCTTGAAGCCATTCTTACAGATGATGAACCAGA
:::::::::::::::::::::::::::::::::::::::::::::::::::::::::::   ::.:::::::::::::::::::::::::::::::::::
CCACCATGTCTCGCCGCAAGCAAGGCAAACCCCAGCACTTAAGCAAACGGGAATTCTCG---GAACCTCTTGAAGCCATTCTTACAGATGATGAACCAGA
P--T--M--S--R--R--K--Q--G--K--P--Q--H--L--S--K--R--E--F--S-----E--P--L--E--A--I--L--T--D--D--E--P--D

----------------------------------------------------------------------------------------------------
--H--G--P--L--G--A--P--E--G--D--H--D--L--L--T--C--G--Q--C--Q--M--N--F--P--L--G--D--I--L--I--F--I--E-
CCACGGCCCGTTGGGAGCTCCAGAAGGGGATCATGACCTCCTCACCTGTGGGCAGTGCCAGATGAACTTCCCATTGGGGGACATTCTTATTTTTATCGAG
::::::::: ::::::::::::::::::::.:::::::::::::: ::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCACGGCCCTTTGGGAGCTCCAGAAGGGGACCATGACCTCCTCACGTGTGGGCAGTGCCAGATGAACTTCCCATTGGGGGACATTCTTATTTTTATCGAG
--H--G--P--L--G--A--P--E--G--D--H--D--L--L--T--C--G--Q--C--Q--M--N--F--P--L--G--D--I--L--I--F--I--E-

----------------------------------------------------------------------------------------------------
-H--K--R--K--Q--C--N--G--S--L--C--L--E--K--A--V--D--K--P--P--S--P--S--P--I--E--M--K--K--A--S--N--P--
CACAAACGGAAACAATGCAATGGCAGCCTCTGCTTAGAAAAAGCTGTGGATAAGCCACCTTCCCCTTCACCAATCGAGATGAAAAAAGCATCCAATCCCG
::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CACAAACGGAAACAATGCAATGGCAGCCTCTGCTTAGAAAAAGCTGTGGATAAGCCACCTTCCCCTTCACCAATCGAGATGAAAAAAGCATCCAATCCCG
-H--K--R--K--Q--C--N--G--S--L--C--L--E--K--A--V--D--K--P--P--S--P--S--P--I--E--M--K--K--A--S--N--P--

-----------------------------------------------------------------------------------------><---------
V--E--V--G--I--Q--V--T--P--E--D--D--D--C--L--S--T--S--S--R--G--I--C--P--K--Q--E--H--I--A--D--K--L--L
TGGAGGTTGGCATCCAGGTCACGCCAGAGGATGACGATTGTTTATCAACGTCATCTAGAGGAATTTGCCCCAAACAGGAACACATAGCAGATAAACTTCT
:::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::   ::::::::
TGGAGGTTGGCATCCAGGTCACGCCAGAGGATGACGATTGTTTATCAACGTCATCTAGAGGAATTTGCCCCAAACAGGAACACATAGCA---AAACTTCT
V--E--V--G--I--Q--V--T--P--E--D--D--D--C--L--S--T--S--S--R--G--I--C--P--K--Q--E--H--I--A-----K--L--L

-------------------------------------------------------------------------------------------><-------
--H--W--R--G--L--S--S--P--R--S--A--H--G--A--L--I--P--T--P--G--M--S--A--E--Y--A--P--Q--G--I--C--K--D-
GCACTGGAGGGGCCTCTCCTCCCCTCGTTCTGCACATGGAGCTCTAATCCCCACGCCTGGGATGAGTGCAGAATATGCCCCGCAGGGTATTTGTAAAGAT
:::::::::::::::::::::::::::::::::::::::::::::::::::::::::.:::::::::::::::::::::::::::::::::         
GCACTGGAGGGGCCTCTCCTCCCCTCGTTCTGCACATGGAGCTCTAATCCCCACGCCCGGGATGAGTGCAGAATATGCCCCGCAGGGTATT---------
--H--W--R--G--L--S--S--P--R--S--A--H--G--A--L--I--P--T--P--G--M--S--A--E--Y--A--P--Q--G--I----------

----------------------------------------------------------------------------------------------------
-E--P--S--S--Y--T--C--T--T--C--K--Q--P--F--T--S--A--W--F--L--L--Q--H--A--Q--N--T--H--G--L--R--I--Y--
GAGCCCAGCAGCTACACATGTACAACTTGCAAACAGCCATTCACCAGTGCATGGTTTCTCTTGCAACACGCACAGAACACTCATGGATTAAGAATCTACT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
L--E--S--E--H--G--S--P--L--T--P--R--V--G--I--P--S--G--L--G--A--E--C--P--S--Q--P--P--L--H--G--I--H--I
TAGAAAGCGAACACGGAAGTCCCCTGACCCCGCGGGTTGGTATCCCTTCAGGACTAGGTGCAGAATGTCCTTCCCAGCCACCTCTCCATGGGATTCATAT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--A--D--N--N--P--F--N--L--L--R--I--P--G--S--V--S--R--E--A--S--G--L--A--E--G--R--F--P--P--T--P--P--L-
TGCAGACAATAACCCCTTTAACCTGCTAAGAATACCAGGATCAGTATCGAGAGAGGCTTCCGGCCTGGCAGAAGGGCGCTTTCCACCCACTCCCCCCCTG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-F--S--P--P--P--R--H--H--L--D--P--H--R--I--E--R--L--G--A--E--E--M--A--L--A--T--H--H--P--S--A--F--D--
TTTAGTCCACCACCGAGACATCACTTGGACCCCCACCGCATAGAGCGCCTGGGGGCGGAAGAGATGGCCCTGGCCACCCATCACCCGAGTGCCTTTGACA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
R--V--L--R--L--N--P--M--A--M--E--P--P--A--M--D--F--S--R--R--L--R--E--L--A--G--N--T--S--S--P--P--L--S
GGGTGCTGCGGTTGAATCCAATGGCTATGGAGCCTCCCGCCATGGATTTCTCTAGGAGACTTAGAGAGCTGGCAGGGAACACGTCTAGCCCACCGCTGTC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--P--G--R--P--S--P--M--Q--R--L--L--Q--P--F--Q--P--G--S--K--P--P--F--L--A--T--P--P--L--P--P--L--Q--S-
CCCAGGCCGGCCCAGCCCTATGCAAAGGTTACTGCAACCATTCCAGCCAGGTAGCAAGCCGCCCTTCCTGGCGACGCCCCCCCTCCCTCCTCTGCAATCC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-A--P--P--P--S--Q--P--P--V--K--S--K--S--C--E--F--C--G--K--T--F--K--F--Q--S--N--L--V--V--H--R--R--S--
GCCCCTCCTCCCTCCCAGCCCCCGGTCAAGTCCAAGTCATGCGAGTTCTGCGGCAAGACGTTCAAATTTCAGAGCAACCTGGTGGTGCACCGGCGCAGCC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
H--T--G--E--K--P--Y--K--C--N--L--C--D--H--A--C--T--Q--A--S--K--L--K--R--H--M--K--T--H--M--H--K--S--S
ACACGGGCGAGAAGCCCTACAAGTGCAACCTGTGCGACCACGCGTGCACCCAGGCCAGCAAGCTGAAGCGCCACATGAAGACGCACATGCACAAATCGTC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--P--M--T--V--K--S--D--D--G--L--S--T--A--S--S--P--E--P--G--T--S--D--L--V--G--S--A--S--S--A--L--K--S-
CCCCATGACGGTCAAGTCCGACGACGGTCTCTCCACCGCCAGCTCCCCGGAACCCGGCACCAGCGACTTGGTGGGCAGCGCCAGCAGCGCGCTCAAGTCC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-V--V--A--K--F--K--S--E--N--D--P--N--L--I--P--E--N--G--D--E--E--E--E--E--D--D--E--E--E--E--E--E--E--
GTGGTGGCCAAGTTCAAGAGCGAGAACGACCCCAACCTGATCCCGGAGAACGGGGACGAGGAGGAAGAGGAGGACGACGAGGAAGAGGAAGAAGAGGAGG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
E--E--E--E--E--E--L--T--E--S--E--R--V--D--Y--G--F--G--L--S--L--E--A--A--R--H--H--E--N--S--S--R--G--A
AAGAGGAGGAGGAGGAGCTGACGGAGAGCGAGAGGGTGGACTACGGCTTCGGGCTGAGCCTGGAGGCGGCGCGCCACCACGAGAACAGCTCGCGGGGCGC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--V--V--G--V--G--D--E--S--R--A--L--P--D--V--M--Q--G--M--V--L--S--S--M--Q--H--F--S--E--A--F--H--Q--V-
GGTCGTGGGCGTGGGCGACGAGAGCCGCGCCCTGCCCGACGTCATGCAGGGCATGGTGCTCAGCTCCATGCAGCACTTCAGCGAGGCCTTCCACCAGGTC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-L--G--E--K--H--K--R--G--H--L--A--E--A--E--G--H--R--D--T--C--D--E--D--S--V--A--G--E--S--D--R--I--D--
CTGGGCGAGAAGCATAAGCGCGGCCACCTGGCCGAGGCCGAGGGCCACAGGGACACTTGCGACGAAGACTCGGTGGCCGGCGAGTCGGACCGCATAGACG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
D--G--T--V--N--G--R--G--C--S--P--G--E--S--A--S--G--G--L--S--K--K--L--L--L--G--S--P--S--S--L--S--P--F
ATGGCACTGTTAATGGCCGCGGCTGCTCCCCGGGCGAGTCGGCCTCGGGGGGCCTGTCCAAAAAGCTGCTGCTGGGCAGCCCCAGCTCGCTGAGCCCCTT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--S--K--R--I--K--L--E--K--E--F--D--L--P--P--A--A--M--P--N--T--E--N--V--Y--S--Q--W--L--A--G--Y--A--A-
CTCTAAGCGCATCAAGCTCGAGAAGGAGTTCGACCTGCCCCCGGCCGCGATGCCCAACACGGAGAACGTGTACTCGCAGTGGCTCGCCGGCTACGCGGCC
                                                                ::::::::::: ::::::::::::::.:: ::::::
----------------------------------------------------------------AACGTGTACTCTCAGTGGCTCGCCGGTTA-GCGGCC
-----------------------------------------------------------------N--V--Y--S--Q--W--L--A--G--Y--A--A-

----------------------------------------------------------------------------------------------------
-S--R--Q--L--K--D--P--F--L--S--F--G--D--S--R--Q--S--P--F--A--S--S--S--E--H--S--S--E--N--G--S--L--R--
TCCAGGCAGCTCAAAGATCCCTTCCTTAGCTTCGGAGACTCCAGACAATCGCCTTTTGCCTCCTCGTCGGAGCACTCCTCGGAGAACGGGAGTTTGCGCT
::::::::::::::::::::::::::::::::::::::::::::::::::::::::.:::::::::::::::::::::::::::::.:::::.:::::::
TCCAGGCAGCTCAAAGATCCCTTCCTTAGCTTCGGAGACTCCAGACAATCGCCTTTCGCCTCCTCGTCGGAGCACTCCTCGGAGAATGGGAGCTTGCGCT
-S--R--Q--L--K--D--P--F--L--S--F--G--D--S--R--Q--S--P--F--A--S--S--S--E--H--S--S--E--N--G--S--L--R--

----------------------------------------------------------------------------------------------------
F--S--T--P--P--G--E--L--D--G--G--I--S--G--R--S--G--T--G--S--G--G--S--T--P--H--I--S--G--P--G--P--G--R
TCTCCACACCGCCCGGGGAGCTGGACGGAGGGATCTCGGGGCGCAGCGGCACGGGAAGTGGAGGGAGCACGCCCCATATTAGTGGTCCGGGCCCGGGCAG
:::::::.::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
TCTCCACGCCGCCCGGGGAGCTGGACGGAGGGATCTCGGGGCGCAGCGGCACGGGAAGTGGAGGGAGCACGCCCCATATTAGTGGTCCGGGCCCGGGCAG
F--S--T--P--P--G--E--L--D--G--G--I--S--G--R--S--G--T--G--S--G--G--S--T--P--H--I--S--G--P--G--P--G--R

----------------------------------------------------------------------------------------------------
--P--S--S--K--E--G--R--R--S--D--T--C--E--Y--C--G--K--V--F--K--N--C--S--N--L--T--V--H--R--R--S--H--T-
GCCCAGCTCAAAAGAGGGCAGACGCAGCGACACTTGTGAGTACTGTGGGAAAGTCTTCAAGAACTGTAGCAATCTCACTGTCCACAGGAGAAGCCACACG
::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
GCCCAGCTCAAAAGAGGGCAGACGCAGCGACACTTGTGAGTACTGTGGGAAAGTCTTCAAGAACTGTAGCAATCTCACTGTCCACAGGAGAAGCCACACG
--P--S--S--K--E--G--R--R--S--D--T--C--E--Y--C--G--K--V--F--K--N--C--S--N--L--T--V--H--R--R--S--H--T-

----------------------------------------------------------------------------------------------------
-G--E--R--P--Y--K--C--E--L--C--N--Y--A--C--A--Q--S--S--K--L--T--R--H--M--K--T--H--G--Q--V--G--K--D--
GGCGAAAGGCCTTATAAATGCGAGCTGTGCAACTATGCCTGTGCCCAGAGTAGCAAGCTCACCAGGCACATGAAAACGCATGGCCAGGTGGGGAAGGACG
::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
GGCGAAAGGCCTTATAAATGCGAGCTGTGCAACTATGCCTGTGCCCAGAGTAGCAAGCTCACCAGGCACATGAAAACGCATGGCCAGGTGGGGAAGGACG
-G--E--R--P--Y--K--C--E--L--C--N--Y--A--C--A--Q--S--S--K--L--T--R--H--M--K--T--H--G--Q--V--G--K--D--

----------------------------------------------------------------------------------------------------
V--Y--K--C--E--I--C--K--M--P--F--S--V--Y--S--T--L--E--K--H--M--K--K--W--H--S--D--R--V--L--N--N--D--I
TTTACAAATGTGAAATTTGTAAGATGCCTTTTAGCGTGTACAGTACCCTGGAGAAACACATGAAAAAATGGCACAGTGATCGAGTGTTGAATAATGATAT
::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
TTTACAAATGTGAAATTTGTAAGATGCCTTTTAGCGTGTACAGTACCCTGGAGAAACACATGAAAAAATGGCACAGTGATCGAGTGTTGAATAATGATAT
V--Y--K--C--E--I--C--K--M--P--F--S--V--Y--S--T--L--E--K--H--M--K--K--W--H--S--D--R--V--L--N--N--D--I

-------------
--K--T--E--*-
AAAAACTGAATAG
:::::::::::::
AAAAACTGAATAG
--K--T--E--*-

Pig Consensus Sequence

>BGISUST0000877014
------AAAGGCACTGATGAAGATATTTTCTCTGGAGTCTCCTTCTTTCTAACCCGGCTCTCCCGATGTGAACCGAGCCGTCGTCCGCCCGCCCCGCAGC
CCACCATGTCTCGCCGCAAGCAAGGCAAACCCCAGCACTTAAGCAAACGGGAATTCTCG---GAACCTCTTGAAGCCATTCTTACAGATGATGAACCAGA
CCACGGCCCTTTGGGAGCTCCAGAAGGGGACCATGACCTCCTCACGTGTGGGCAGTGCCAGATGAACTTCCCATTGGGGGACATTCTTATTTTTATCGAG
CACAAACGGAAACAATGCAATGGCAGCCTCTGCTTAGAAAAAGCTGTGGATAAGCCACCTTCCCCTTCACCAATCGAGATGAAAAAAGCATCCAATCCCG
TGGAGGTTGGCATCCAGGTCACGCCAGAGGATGACGATTGTTTATCAACGTCATCTAGAGGAATTTGCCCCAAACAGGAACACATAGCA---AAACTTCT
GCACTGGAGGGGCCTCTCCTCCCCTCGTTCTGCACATGGAGCTCTAATCCCCACGCCCGGGATGAGTGCAGAATATGCCCCGCAGGGTATT---------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------AACGTGTACTCTCAGTGGCTCGCCGGtgCGGCCTCC
AGGCAGCTCAAAGATCCCTTCCTTAGCTTCGGAGACTCCAGACAATCGCCTTTCGCCTCCTCGTCGGAGCACTCCTCGGAGAATGGGAGCTTGCGCTTCT
CCACGCCGCCCGGGGAGCTGGACGGAGGGATCTCGGGGCGCAGCGGCACGGGAAGTGGAGGGAGCACGCCCCATATTAGTGGTCCGGGCCCGGGCAGGCC
CAGCTCAAAAGAGGGCAGACGCAGCGACACTTGTGAGTACTGTGGGAAAGTCTTCAAGAACTGTAGCAATCTCACTGTCCACAGGAGAAGCCACACGGGC
GAAAGGCCTTATAAATGCGAGCTGTGCAACTATGCCTGTGCCCAGAGTAGCAAGCTCACCAGGCACATGAAAACGCATGGCCAGGTGGGGAAGGACGTTT
ACAAATGTGAAATTTGTAAGATGCCTTTTAGCGTGTACAGTACCCTGGAGAAACACATGAAAAAATGGCACAGTGATCGAGTGTTGAATAATGATATAAA
AACTGAATAG


>BGISUSP0000877014
--KGTDEDIFSGVSFFLTRLSRCEPSRRPPAPQPTMSRRKQGKPQHLSKREFS-EPLEAILTDDEPDHGPLGAPEGDHDLLTCGQCQMNFPLGDILIFIE
HKRKQCNGSLCLEKAVDKPPSPSPIEMKKASNPVEVGIQVTPEDDDCLSTSSRGICPKQEHIA-KLLHWRGLSSPRSAHGALIPTPGMSAEYAPQGI---
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------NVYSQWLAGAAS
RQLKDPFLSFGDSRQSPFASSSEHSSENGSLRFSTPPGELDGGISGRSGTGSGGSTPHISGPGPGRPSSKEGRRSDTCEYCGKVFKNCSNLTVHRRSHTG
ERPYKCELCNYACAQSSKLTRHMKTHGQVGKDVYKCEICKMPFSVYSTLEKHMKKWHSDRVLNNDIKTE*