Sequences
AJ666494est
rbyd_80403.y1reads
AJ669334est
rste13_c17.y1est
rpgl23_p20.y1est
rese16c_n6.y1est
rlnt32c_e1.y1est
rste18_i2.y1est
rthg06_m13.y1est
reru21c_p4.y1est
rnca33b_k9.y1est
relu1335c_e21r1.y1est
CF362434est
rova024_f9.y1est
ruio27_b18.y1est
rcbl0_007974.y1est
rpliv0131_c22.y1est
rthg19_n23.y1est
rby_92465.y1reads
BP461925est
ruio03_j21.y1est
rfat0116_g8.y1est
ruio19_n15.y1est
rpliv0104_m6.y1est
rebs02c_g3.y1est
rspl31_g11.y1est
rese18c_e9.y1est
rpliv0117_k5.y1est
BP161498est
rnbm40b_i12.y1est
CX061555est
rspl39_d13.y1est
BI337321est
CV870547est
rspl11_h6.y1est
CF361031est
rmcp14c_h19.y1est
rebs34c_m14.y1est
ruio15_n11.y1est
rnmm08c_i9.y1est
rspl11_m16.y1est
rplun0106_m16.y1est
rpliv0139_g10.y1est
BW980444est
BI181108est
reye1623b_d4r1.y1est
rspl19_b5.y1est
BP456813est
rnco1929b_b23.y1est
BI182298est
CJ020263est
rpliv0135_f6.y1est
CO989671est
rtra34_e20.y1est
BP169334est
CO941377est
rcki23_l15.y1est
rste16_j9.y1est
AJ663502est
rjej34b_o2.y1est
relu1306b_f15.y1est
reye1638b_h16.y1est
rcki33_e14.y1est
rpliv0112_m15.y1est
rcje34_n24.y1est
rnco1936b_n5.y1est
CJ020810est
DV225961est
rebs35c_f5.y1est
rthg04_o11.y1est
rski0118_i24.y1est
BP462255est
DN113118est
relu1313b_n4r1.y1est
DV229175est
CJ005325est
rpliv0109_f19.y1est
DV227591est
AU296205est
DV224869est
rova009_k20.y1est
AJ667252est
rnmm25c_o6.y1est
rplun0126_k15.y1est
ramn3525b_o24.y1est
reye1630b_l24r1.y1est
rfat0109_m24.y1est
rnco1921b_n5.y1est
rbla_82826.y1reads
rlin19_c18.y1est
CB287546est
rlyg19_o6.y1est
rski0139_e11.y1est
rtes31_h7.y1est
rpldo0123_h22.y1est
ruio09_a7.y1est
rfat0105_c16.y1est
ruio20_e20.y1est
rplun0126_i7.y1est
ruio06_n23.y1est
rova029_p16.y1est
rche12_l4.y1est
reje24b_j9.y1est
reje01b_d20.y1est
BX917923est
rpro35_p14.y1est
rspl24_n3.y1est
rsin32_h13.y1est
rpliv0116_k21.y1est
rece02c_n9.y1est
rcut30_d6.y1est
rton1203b_d2.y1est
rpliv0116_b1.y1est
rsme001_k19.y1est
rspl30_b23.y1est
rsin10_j24.y1est
BX669885est
rste02_d18.y1est
raor012_i24.y1est
rpliv0115_d12.y1est
rcut18_g7.y1est
reye1621b_a17.y1est
rsme012_n17.y1est
rsme025_g15.y1est
rpliv0126_f14.y1est
rspl17_a6.y1est
rpliv0112_g20.y1est
rcsk12_e9.y1est
rvin021_b18.y1est
EST Library Info
amn3Amnion
aor1Aorta
cbl1Blood
che1Heart - RNA from China
cje1Jejunum - RNA from China
cki1Kidney - RNA from China
csk2Skin - RNA from China
cut5Uterus - RNA from China
ebs6Foetus 50 days, brain stem
ece1Foetus 50 days, cerebellum
eje2Foetus 50 days, jejunum
elu1Foetus 50 days, lung
eru1Foetus 50 days, regio umbilicalis
ese2Foetus 50 days, M. semitendinosus
eye4Foetus 50 days, Eye
fat3Fatt
lin1Large intestine
lnt4Lymphatic nodule tracheobroncalis
lyg1Lymphatic gland
mcp1Mammae, collostrum producing
nca1Newborn 115 days, cartillage
nco8Newborn 115 days, colon
nmm4Newborn 115 days, mucosal membranes
ova4Ovary
pgl1Pituitary gland
pldo1Unavailable
pliv13Unavailable
plun5Unavailable
pro1Prostata
relu3Unavailable
sin4Small intestine
ski3Skin
sme5M. Semimembranosus
spl8Spleen
ste6M. Semitendinosus
tes1Testes
thg2Thyroid gland
ton2Tip of tongue, mucosal membrane
tra1Trachea
uio10Unavailable
vin1M. Vastus intermedius
Clusters
Oligos
SNPs

Gene ID ENSG00000169045 (click for geneview)
Transcript ID ENST00000356731(link to ensembl)
Symbol HNRPH1
Localtion Chromosome:5:178973786:178984276:-1 band: 5q35.3
Description Heterogeneous nuclear ribonucleoprotein H (hnRNP H). [Source:Uniprot/SWISSPROT;Acc:P31943]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<-----------------------------------------------------------------------------------------------><--
-M--M--L--G--T--E--G--G--E--G--F--V--V--K--V--R--G--L--P--W--S--C--S--A--D--E--V--Q--R--F--F--S--D--
ATGATGTTGGGCACGGAAGGTGGAGAGGGATTCGTGGTGAAGGTCCGGGGCTTGCCCTGGTCTTGCTCGGCCGATGAAGTGCAGAGGTTTTTTTCTGACT
:::::::::::::: :::::.:::::::::::::::::::::::::::::::::::::::::.:::::::: ::.::::::::: :::::::::::   :
ATGATGTTGGGCACCGAAGGCGGAGAGGGATTCGTGGTGAAGGTCCGGGGCTTGCCCTGGTCCTGCTCGGCGGACGAAGTGCAGCGGTTTTTTTCT---T
-M--M--L--G--T--E--G--G--E--G--F--V--V--K--V--R--G--L--P--W--S--C--S--A--D--E--V--Q--R--F--F--S-----

----------------------------------------------------------------------------------------------------
C--K--I--Q--N--G--A--Q--G--I--R--F--I--Y--T--R--E--G--R--P--S--G--E--A--F--V--E--L--E--S--E--D--E--V
GCAAAATTCAAAATGGGGCTCAAGGTATTCGTTTCATCTACACCAGAGAAGGCAGACCAAGTGGCGAGGCTTTTGTTGAACTTGAATCAGAAGATGAAGT
::::::::::::::::::::::::::::::::::::::::::::::::::::::::::.:::::::::::::::::::::::::::::::::::::::::
GCAAAATTCAAAATGGGGCTCAAGGTATTCGTTTCATCTACACCAGAGAAGGCAGACCGAGTGGCGAGGCTTTTGTTGAACTTGAATCAGAAGATGAAGT
C--K--I--Q--N--G--A--Q--G--I--R--F--I--Y--T--R--E--G--R--P--S--G--E--A--F--V--E--L--E--S--E--D--E--V

----------------------------------------------------><----------------------------------------------
--K--L--A--L--K--K--D--R--E--T--M--G--H--R--Y--V--E--V--F--K--S--N--N--V--E--M--D--W--V--L--K--H--T-
CAAATTGGCCCTGAAAAAAGACAGAGAAACTATGGGACACAGATATGTTGAAGTATTCAAGTCAAACAACGTTGAAATGGATTGGGTGTTGAAGCATACT
::::::::::::::::::::::::::::::::::::::::::::::::::::   :::::::::::::::::::::::::::::::::::::::::::::
CAAATTGGCCCTGAAAAAAGACAGAGAAACTATGGGACACAGATATGTTGAA---TTCAAGTCAAACAACGTTGAAATGGATTGGGTGTTGAAGCATACT
--K--L--A--L--K--K--D--R--E--T--M--G--H--R--Y--V--E-----F--K--S--N--N--V--E--M--D--W--V--L--K--H--T-

------------------------------------------------------------------------------------------------><--
-G--P--N--S--P--D--T--A--N--D--G--F--V--R--L--R--G--L--P--F--G--C--S--K--E--E--I--V--Q--F--F--S--G--
GGTCCAAATAGTCCTGACACGGCCAATGATGGCTTTGTACGGCTTAGAGGACTTCCCTTTGGATGTAGCAAGGAAGAAATTGTTCAGTTCTTCTCAGGGT
:::::::::::::::::::::::::::::::::::::::::::::::::::::.::::::::::::::::::::::::::::::::::::::::::   :
GGTCCAAATAGTCCTGACACGGCCAATGATGGCTTTGTACGGCTTAGAGGACTCCCCTTTGGATGTAGCAAGGAAGAAATTGTTCAGTTCTTCTCA---T
-G--P--N--S--P--D--T--A--N--D--G--F--V--R--L--R--G--L--P--F--G--C--S--K--E--E--I--V--Q--F--F--S-----

----------------------------------------------------------------------------------------------------
L--E--I--V--P--N--G--I--T--L--P--V--D--F--Q--G--R--S--T--G--E--A--F--V--Q--F--A--S--Q--E--I--A--E--K
TGGAAATCGTGCCAAATGGGATAACATTGCCGGTGGACTTCCAGGGGAGGAGTACGGGGGAGGCCTTCGTGCAGTTTGCTTCACAGGAAATAGCTGAAAA
::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
TGGAAATCGTGCCAAATGGGATAACATTGCCGGTGGACTTCCAGGGGAGGAGTACGGGGGAGGCCTTCGTGCAGTTTGCTTCACAGGAAATAGCTGAAAA
L--E--I--V--P--N--G--I--T--L--P--V--D--F--Q--G--R--S--T--G--E--A--F--V--Q--F--A--S--Q--E--I--A--E--K

-----------------------------------><---------------------------------------------------------------
--A--L--K--K--H--K--E--R--I--G--H--R--Y--I--E--I--F--K--S--S--R--A--E--V--R--T--H--Y--D--P--P--R--K-
GGCTCTAAAGAAACACAAGGAAAGAATAGGGCACAGGTATATTGAAATCTTTAAGAGCAGTAGAGCTGAAGTTAGAACTCATTATGATCCACCACGAAAG
::::::::::::::::::::::::::::::::::   :::::.:::::::::::::::::: : :::::::::::::::::.:::::::: ::::::::.
GGCTCTAAAGAAACACAAGGAAAGAATAGGGCAC---TATATCGAAATCTTTAAGAGCAGTCGTGCTGAAGTTAGAACTCACTATGATCCTCCACGAAAA
--A--L--K--K--H--K--E--R--I--G--H-----Y--I--E--I--F--K--S--S--R--A--E--V--R--T--H--Y--D--P--P--R--K-

----------------------------------------------------------------------------------------------------
-L--M--A--M--Q--R--P--G--P--Y--D--R--P--G--A--G--R--G--Y--N--S--I--G--R--G--A--G--F--E--R--M--R--R--
CTTATGGCCATGCAGCGGCCAGGTCCTTATGACAGACCTGGGGCTGGTAGAGGGTATAACAGCATTGGCAGAGGAGCTGGCTTTGAGAGGATGAGGCGTG
:::::::::::::::::.::::::::.::::::::::::::::::::.:::::::::::::::::::::::.::::::::::::::.:::::::::::::
CTTATGGCCATGCAGCGACCAGGTCCCTATGACAGACCTGGGGCTGGCAGAGGGTATAACAGCATTGGCAGGGGAGCTGGCTTTGAAAGGATGAGGCGTG
-L--M--A--M--Q--R--P--G--P--Y--D--R--P--G--A--G--R--G--Y--N--S--I--G--R--G--A--G--F--E--R--M--R--R--

--------------><----------------------------------------------------------------------><------------
G--A--Y--G--G--G--Y--G--G--Y--D--D--Y--N--G--Y--N--D--G--Y--G--F--G--S--D--R--F--G--R--D--L--N--Y--C
GTGCTTATGGTGGAGGCTATGGAGGCTATGATGATTACAATGGCTATAATGATGGCTATGGATTTGGGTCAGATAGATTTGGAAGAGACCTCAATTACTG
::::::::::::::   ::::::::::::::::::::.:::::::::::::::::::::::::::::.::::::::::::::::::   :::::::::::
GTGCTTATGGTGGA---TATGGAGGCTATGATGATTATAATGGCTATAATGATGGCTATGGATTTGGATCAGATAGATTTGGAAGA---CTCAATTACTG
G--A--Y--G--G-----Y--G--G--Y--D--D--Y--N--G--Y--N--D--G--Y--G--F--G--S--D--R--F--G--R-----L--N--Y--C

----------------------------------------------------------------------------------------------------
--F--S--G--M--S--D--H--R--Y--G--D--G--G--S--T--F--Q--S--T--T--G--H--C--V--H--M--R--G--L--P--Y--R--A-
TTTTTCAGGAATGTCTGATCACAGATACGGGGATGGTGGCTCTACTTTCCAGAGCACAACAGGACACTGTGTACACATGCGGGGATTACCTTACAGAGCT
::::::::::::::: ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
TTTTTCAGGAATGTCAGATCACAGATACGGGGATGGTGGCTCTACTTTCCAGAGCACAACAGGACACTGTGTACACATGCGGGGATTACCTTACAGAGCT
--F--S--G--M--S--D--H--R--Y--G--D--G--G--S--T--F--Q--S--T--T--G--H--C--V--H--M--R--G--L--P--Y--R--A-

--------------------><------------------------------------------------------------------------------
-T--E--N--D--I--Y--N--F--F--S--P--L--N--P--V--R--V--H--I--E--I--G--P--D--G--R--V--T--G--E--A--D--V--
ACTGAGAATGACATTTATAATTTTTTTTCACCGCTCAACCCTGTGAGAGTACACATTGAAATTGGTCCTGATGGCAGAGTAACTGGTGAAGCAGATGTCG
::::::::::::::::::::::::::::::::.::::::::::::::::::::.:::::::::::::::::::::::::::::::::::::::::::: :
ACTGAGAATGACATTTATAATTTTTTTTCACCACTCAACCCTGTGAGAGTACATATTGAAATTGGTCCTGATGGCAGAGTAACTGGTGAAGCAGATGTGG
-T--E--N--D--I--Y--N--F--F--S--P--L--N--P--V--R--V--H--I--E--I--G--P--D--G--R--V--T--G--E--A--D--V--

--------------------------------------------------------><------------------------------------------
E--F--A--T--H--E--D--A--V--A--A--M--S--K--D--K--A--N--M--Q--H--R--Y--V--E--L--F--L--N--S--T--A--G--A
AGTTCGCAACTCATGAAGATGCTGTGGCAGCTATGTCAAAAGACAAAGCAAATATGCAACACAGATATGTAGAACTCTTCTTGAATTCTACAGCAGGAGC
::::.::::::::::::::::: :::::::::::::::::::::::::::::::::                                            
AGTTTGCAACTCATGAAGATGCAGTGGCAGCTATGTCAAAAGACAAAGCAAATATG--------------------------------------------
E--F--A--T--H--E--D--A--V--A--A--M--S--K--D--K--A--N--M---------------------------------------------

----------------><----------------------------------------------------------------------------------
--S--G--G--A--Y--E--H--R--Y--V--E--L--F--L--N--S--T--A--G--A--S--G--G--A--Y--G--S--Q--M--M--G--G--M-
AAGCGGTGGTGCTTACGAACACAGATATGTAGAACTCTTCTTGAATTCTACAGCAGGAGCAAGCGGTGGTGCTTATGGTAGCCAAATGATGGGAGGCATG
                   ::::::::::::::::::::::::::::::::::::::::::::::::::::::::.:::::::::::: :.:::::::::
-------------------CACAGATATGTAGAACTCTTCTTGAATTCTACAGCAGGAGCAAGCGGTGGTGCTTACGGTAGCCAAATGCTAGGAGGCATG
--------------------H--R--Y--V--E--L--F--L--N--S--T--A--G--A--S--G--G--A--Y--G--S--Q--M--L--G--G--M-

------><------------------------------------------------------------------------------------------->
-G--L--S--N--Q--S--S--Y--G--G--P--A--S--Q--Q--L--S--G--G--Y--G--G--G--Y--G--G--Q--S--S--M--S--G--Y--
GGCTTGTCAAACCAGTCCAGCTACGGGGGCCCAGCCAGCCAGCAGCTGAGTGGGGGTTACGGAGGCGGCTACGGTGGCCAGAGCAGCATGAGTGGATACG
::.:::   :::::::::::.::.:: ::::::::.::::::::::::::::: :::::.::::::::.::.::::::::::::::::::::::::    
GGTTTG---AACCAGTCCAGTTATGGTGGCCCAGCTAGCCAGCAGCTGAGTGGTGGTTATGGAGGCGGTTATGGTGGCCAGAGCAGCATGAGTGGA----
-G--L-----N--Q--S--S--Y--G--G--P--A--S--Q--Q--L--S--G--G--Y--G--G--G--Y--G--G--Q--S--S--M--S--G-----

<------------------------------------------------>
D--Q--V--L--Q--E--N--S--S--D--F--Q--S--N--I--A--*-
ACCAAGTTTTACAGGAAAACTCCAGTGATTTTCAATCAAACATTGCATAG
                                                  
--------------------------------------------------
--------------------------------------------------

Pig Consensus Sequence

>BGISUST0000877632
ATGATGTTGGGCACCGAAGGCGGAGAGGGATTCGTGGTGAAGGTCCGGGGCTTGCCCTGGTCCTGCTCGGCGGACGAAGTGCAGCGGTTTTTTTCT---T
GCAAAATTCAAAATGGGGCTCAAGGTATTCGTTTCATCTACACCAGAGAAGGCAGACCGAGTGGCGAGGCTTTTGTTGAACTTGAATCAGAAGATGAAGT
CAAATTGGCCCTGAAAAAAGACAGAGAAACTATGGGACACAGATATGTTGAA---TTCAAGTCAAACAACGTTGAAATGGATTGGGTGTTGAAGCATACT
GGTCCAAATAGTCCTGACACGGCCAATGATGGCTTTGTACGGCTTAGAGGACTCCCCTTTGGATGTAGCAAGGAAGAAATTGTTCAGTTCTTCTCA---T
TGGAAATCGTGCCAAATGGGATAACATTGCCGGTGGACTTCCAGGGGAGGAGTACGGGGGAGGCCTTCGTGCAGTTTGCTTCACAGGAAATAGCTGAAAA
GGCTCTAAAGAAACACAAGGAAAGAATAGGGCAC---TATATCGAAATCTTTAAGAGCAGTCGTGCTGAAGTTAGAACTCACTATGATCCTCCACGAAAA
CTTATGGCCATGCAGCGACCAGGTCCCTATGACAGACCTGGGGCTGGCAGAGGGTATAACAGCATTGGCAGGGGAGCTGGCTTTGAAAGGATGAGGCGTG
GTGCTTATGGTGGA---TATGGAGGCTATGATGATTATAATGGCTATAATGATGGCTATGGATTTGGATCAGATAGATTTGGAAGA---CTCAATTACTG
TTTTTCAGGAATGTCAGATCACAGATACGGGGATGGTGGCTCTACTTTCCAGAGCACAACAGGACACTGTGTACACATGCGGGGATTACCTTACAGAGCT
ACTGAGAATGACATTTATAATTTTTTTTCACCACTCAACCCTGTGAGAGTACATATTGAAATTGGTCCTGATGGCAGAGTAACTGGTGAAGCAGATGTGG
AGTTTGCAACTCATGAAGATGCAGTGGCAGCTATGTCAAAAGACAAAGCAAATATG--------------------------------------------
-------------------CACAGATATGTAGAACTCTTCTTGAATTCTACAGCAGGAGCAAGCGGTGGTGCTTACGGTAGCCAAATGCTAGGAGGCATG
GGTTTG---AACCAGTCCAGTTATGGTGGCCCAGCTAGCCAGCAGCTGAGTGGTGGTTATGGAGGCGGTTATGGTGGCCAGAGCAGCATGAGTGGA----
--------------------------------------------------


>BGISUSP0000877632
MMLGTEGGEGFVVKVRGLPWSCSADEVQRFFS-CKIQNGAQGIRFIYTREGRPSGEAFVELESEDEVKLALKKDRETMGHRYVE-FKSNNVEMDWVLKHT
GPNSPDTANDGFVRLRGLPFGCSKEEIVQFFS-LEIVPNGITLPVDFQGRSTGEAFVQFASQEIAEKALKKHKERIGH-YIEIFKSSRAEVRTHYDPPRK
LMAMQRPGPYDRPGAGRGYNSIGRGAGFERMRRGAYGG-YGGYDDYNGYNDGYGFGSDRFGR-LNYCFSGMSDHRYGDGGSTFQSTTGHCVHMRGLPYRA
TENDIYNFFSPLNPVRVHIEIGPDGRVTGEADVEFATHEDAVAAMSKDKANM---------------------HRYVELFLNSTAGASGGAYGSQMLGGM
GL-NQSSYGGPASQQLSGGYGGGYGGQSSMSG------------------