Sequences
EST Library Info
elu1Foetus 50 days, lung
med1Mediastinum
nco2Newborn 115 days, colon
ute1Uterus
Clusters
Oligos
SNPs

Gene ID ENSG00000197226 (click for geneview)
Transcript ID ENST00000356834(link to ensembl)
Symbol NP_942568.2
Localtion Chromosome:5:179221679:179267464:-1 band: 5q35.3
Description KIAA0676 protein isoform a
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-R--G--P--R--P--G--A--S--G--S--A--M--A--L--W--V--T--E--R--A--N--P--F--F--V--L--Q--R--R--R--G--H--G--
CGCGGGCCTCGGCCCGGTGCGAGCGGCTCCGCGATGTGGCTGAGCCCGGAGGAGGTGCTGGTGGCCAATGCGCTGTGGGTGACGGAGCGGGCCAACCCCT
                                      :::: :  .:. ::::  : . .   ::  . .  ::. :  :  : . :::: : ::  : 
------------------------------------GCGCTGTGGGTGACGGAGCGGGCCAACCCCTTCTTTGTGCTGCAGCGGCGCCGGGGCCACGGCA
-------------------------------------A--L--W--V--T--E--R--A--N--P--F--F--V--L--Q--R--R--R--G--H--G--

--------------------------------------------------><------------------------------------------------
R--G--G--G--L--T--R--R--G--H--G--R--G--G--G--L--T--G--L--L--V--G--T--L--D--V--V--L--D--S--S--A--R--V
TCTTCGTGCTGCAGCGACGCCGGGGCCACGGCAGGGGCGGCGGCCTTACGGGTCTTCTCGTGGGCACCCTGGACGTGGTGCTGGACTCCAGTGCCCGCGT
    ::    ::    .                                    :::::::::::::::.:::::::::::::::::::.::.::::: ::
AGGGCGGCGGGCTCACG------------------------------------CTTCTCGTGGGCACCTTGGACGTGGTGCTGGACTCTAGCGCCCGGGT
K--G--G--G--L--T--------------------------------------L--L--V--G--T--L--D--V--V--L--D--S--S--A--R--V

-------------------------------------------------------------><-------------------------------------
--A--P--Y--R--I--L--H--Q--T--Q--D--S--Q--V--Y--W--T--V--A--C--G--S--S--R--K--E--I--T--K--H--W--E--W-
GGCCCCTTACCGCATCCTGCACCAGACCCAGGACTCCCAGGTCTACTGGACAGTGGCGTGTGGTTCTTCCCGCAAAGAGATCACAAAACACTGGGAATGG
::::::::::::.:::::::::::::::::::::::.::::::::::::::::::::.      ::::::::::::::.:::::::::::::::::::::
GGCCCCTTACCGTATCCTGCACCAGACCCAGGACTCTCAGGTCTACTGGACAGTGGCA------TCTTCCCGCAAAGAAATCACAAAACACTGGGAATGG
--A--P--Y--R--I--L--H--Q--T--Q--D--S--Q--V--Y--W--T--V--A--------S--S--R--K--E--I--T--K--H--W--E--W-

--------------------------------------------------------------------------------><------------------
-L--E--N--N--L--L--Q--T--L--S--I--F--D--S--E--E--D--I--T--T--F--V--K--G--K--I--H--G--I--I--A--E--E--
CTGGAAAATAACTTGCTCCAGACACTGTCCATCTTCGACAGTGAGGAAGATATCACCACCTTCGTCAAGGGCAAGATACACGGAATCATCGCAGAAGAGA
::::::::.:::::.::.::::  :::::::::::.::::.::::::.:::::.:::::  :::::::::::::::::   :: ::::::::::::::::
CTGGAAAACAACTTACTTCAGAATCTGTCCATCTTTGACAATGAGGAGGATATTACCACGATCGTCAAGGGCAAGATA---GGCATCATCGCAGAAGAGA
-L--E--N--N--L--L--Q--N--L--S--I--F--D--N--E--E--D--I--T--T--I--V--K--G--K--I-----G--I--I--A--E--E--

----------------------------------------------------------------------------------------------------
N--K--N--L--Q--P--Q--G--D--E--D--P--G--K--F--K--E--A--E--L--K--M--R--K--Q--F--G--M--P--E--G--E--K--L
ACAAGAACCTGCAGCCCCAGGGAGACGAGGACCCCGGGAAGTTCAAGGAGGCTGAGCTGAAGATGCGGAAGCAGTTTGGGATGCCTGAGGGCGAGAAGCT
::::::::::::::::::::::::::::::::::.:::::::::::::::::.::::::::::::::::::::::::::::::::.::::: ::::::::
ACAAGAACCTGCAGCCCCAGGGAGACGAGGACCCTGGGAAGTTCAAGGAGGCCGAGCTGAAGATGCGGAAGCAGTTTGGGATGCCCGAGGGGGAGAAGCT
N--K--N--L--Q--P--Q--G--D--E--D--P--G--K--F--K--E--A--E--L--K--M--R--K--Q--F--G--M--P--E--G--E--K--L

----------------------------------------------------------------------------------------------------
--V--N--Y--Y--S--C--S--Y--W--K--G--R--V--P--R--Q--G--W--L--Y--L--T--V--N--H--L--C--F--Y--S--F--L--L-
GGTGAATTACTACTCCTGCAGCTACTGGAAGGGCCGCGTGCCCCGGCAGGGCTGGCTGTACCTGACGGTCAACCACCTGTGCTTCTACTCCTTCCTGCTG
::: ::.::::::::::::::::::::::::::::..:::::::::::::::::::: :::::::: ::::::::::::::.::::::::::::::::::
GGTCAACTACTACTCCTGCAGCTACTGGAAGGGCCATGTGCCCCGGCAGGGCTGGCTCTACCTGACTGTCAACCACCTGTGTTTCTACTCCTTCCTGCTG
--V--N--Y--Y--S--C--S--Y--W--K--G--H--V--P--R--Q--G--W--L--Y--L--T--V--N--H--L--C--F--Y--S--F--L--L-

---------><-----------------------------------------------------------------------------------------
-G--K--E--V--S--L--V--V--Q--W--V--D--I--T--R--L--E--K--N--A--T--L--L--F--P--E--S--I--R--V--D--T--R--
GGGAAGGAAGTGAGCCTCGTGGTGCAGTGGGTGGACATAACGCGTCTGGAGAAGAACGCCACCCTGCTCTTCCCCGAGAGCATCCGTGTGGACACCCGCG
:: :::      ::::: :::::::.::::::::::.: ::.:: ::::::::::::::::: ::::: :::::.::::::::::: ::::::::::: :
GGCAAG------AGCCTGGTGGTGCGGTGGGTGGACGTCACACGGCTGGAGAAGAACGCCACACTGCTGTTCCCTGAGAGCATCCGGGTGGACACCCGGG
-G--K--------S--L--V--V--R--W--V--D--V--T--R--L--E--K--N--A--T--L--L--F--P--E--S--I--R--V--D--T--R--

----------------------------------------------------------------------------------------------------
D--Q--E--L--F--F--S--M--F--L--N--I--G--E--T--F--K--L--M--E--Q--L--A--N--L--A--M--R--Q--L--L--D--S--E
ACCAGGAGCTCTTCTTCTCCATGTTCCTCAACATCGGCGAGACCTTCAAGCTCATGGAGCAGTTGGCCAACCTGGCCATGCGGCAGCTGCTGGACAGCGA
:::::::::::::::::::::::::::::::::::. .::::::::::::::::::::::::.::::.::::::::::::::::::::::::::::::::
ACCAGGAGCTCTTCTTCTCCATGTTCCTCAACATCACTGAGACCTTCAAGCTCATGGAGCAGCTGGCTAACCTGGCCATGCGGCAGCTGCTGGACAGCGA
D--Q--E--L--F--F--S--M--F--L--N--I--T--E--T--F--K--L--M--E--Q--L--A--N--L--A--M--R--Q--L--L--D--S--E

--------------------------------------------------------------------><------------------------------
--G--F--L--E--D--K--A--L--P--R--P--I--R--P--H--R--N--I--S--A--L--K--R--D--L--D--A--R--A--K--N--E--C-
GGGCTTCCTGGAGGACAAGGCCCTGCCTAGGCCCATCCGGCCACACAGGAACATCTCAGCCCTGAAGCGAGACCTGGACGCCCGAGCCAAGAATGAGTGC
::::::::::::::::::::: :::::.:::::: .::.:::.::::.::: ::.::.::.:::                                    
GGGCTTCCTGGAGGACAAGGCGCTGCCCAGGCCCCCCCAGCCGCACAAGAAAATTTCGGCTCTG------------------------------------
--G--F--L--E--D--K--A--L--P--R--P--P--Q--P--H--K--K--I--S--A--L-------------------------------------

----------------------------------------------------------------------------------------------------
-Y--R--A--T--F--R--L--P--R--D--E--R--L--D--G--H--T--S--C--T--L--W--T--P--F--N--K--L--H--I--P--G--Q--
TACCGAGCCACGTTCCGGCTGCCCAGGGATGAGCGGCTAGACGGCCACACAAGCTGCACCCTGTGGACGCCGTTCAACAAGCTGCACATCCCTGGCCAGA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------><----------------------
M--F--I--S--N--N--Y--I--C--F--A--S--K--E--E--D--A--C--H--L--I--I--P--L--R--E--V--T--I--V--E--K--A--D
TGTTCATCTCCAACAACTACATCTGCTTCGCCAGCAAGGAGGAGGACGCTTGCCACCTCATCATACCCCTGAGGGAGGTGACCATTGTCGAAAAAGCTGA
                                                                             :::::::::::::::::::::::
-----------------------------------------------------------------------------GTGACCATTGTCGAAAAAGCTGA
------------------------------------------------------------------------------V--T--I--V--E--K--A--D

----------------------------------------------------------------------------------------------------
--S--S--S--V--L--P--S--P--L--S--I--S--T--K--S--K--M--T--F--L--F--A--N--L--K--D--R--D--F--L--V--Q--R-
CAGCTCCAGCGTGCTGCCCAGCCCCCTGTCCATCAGCACCAAAAGCAAAATGACATTCCTGTTTGCCAACCTGAAAGACCGTGATTTCTTGGTGCAGAGG
::::::..:.:: :::::::::::.::::::::.::::::::.::::::::::: ::::::::.::::::::::::::::: ::::::::::: ::::::
CAGCTCTGGTGTCCTGCCCAGCCCTCTGTCCATTAGCACCAAGAGCAAAATGACCTTCCTGTTCGCCAACCTGAAAGACCGAGATTTCTTGGTTCAGAGG
--S--S--G--V--L--P--S--P--L--S--I--S--T--K--S--K--M--T--F--L--F--A--N--L--K--D--R--D--F--L--V--Q--R-

-----------------------------------------------------------------------------------------><---------
-I--S--D--F--L--Q--K--T--P--S--K--Q--P--G--S--I-----G--S--R--K--A--S--V--V--D--P--S--T--E--S--S--P--
ATCTCTGACTTCCTCCAGAAAACACCATCCAAGCAGCCAGGCAGTATC---GGGAGCAGGAAAGCCAGTGTTGTGGACCCTAGCACAGAGTCTTCCCCAG
:::::.::::::::::::::::..::.:::::::::::.:::::.: :   : ..  ::::::.::::..:::..::::: . : :::::          
ATCTCCGACTTCCTCCAGAAAATGCCGTCCAAGCAGCCGGGCAGCAGCAGAGCAGCAAGGAAAACCAGCATTGCAGACCCAGCCCCAGAG----------
-I--S--D--F--L--Q--K--M--P--S--K--Q--P--G--S--S--R--A--A--R--K--T--S--I--A--D--P--A--P--E-----------

----------------------------------------------------------------------------------------------------
A--P--Q--E--G--S--E--Q--P--A--S--P--A--S--P--L--S--S--R--Q--S--F--C--A--Q--E--A--P--T--A--S--Q--G--L
CTCCTCAGGAGGGGTCGGAGCAGCCCGCCAGCCCAGCCTCTCCCCTCAGCAGCCGCCAGAGCTTCTGTGCGCAGGAGGCGCCAACCGCATCCCAGGGCCT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

---------------------------------------------------><-----------------------------------------------
--L--K--L--F--Q--K--N--S--P--M--E--D--L--G--A--K--G--A--K--E--K--M--K--E--E--S--W--H--I--H--F--F--E-
GCTGAAGCTCTTCCAGAAAAACTCGCCCATGGAGGACCTTGGAGCCAAGGGGGCCAAGGAGAAGATGAAAGAGGAGTCATGGCACATCCACTTCTTCGAG
                                                                                              ::.:::
----------------------------------------------------------------------------------------------TTTGAG
-----------------------------------------------------------------------------------------------F--E-

----------------------------------------------------------------------------------------------------
-Y--G--R--G--V--C--M--Y--R--T--A--K--T--R--A--L--V--L--K--G--I--P--E--S--L--R--G--E--L--W--L--L--F--
TACGGGCGTGGCGTGTGCATGTACCGCACAGCCAAGACGCGGGCACTGGTCCTGAAGGGTATCCCTGAGAGCCTCCGGGGAGAGCTGTGGCTCCTCTTCT
: ::::::.:::.::::::::::::::::.::::..::::::: .::::: ::::::::.:::::.:::::::: :::::.:::::::::::::::::: 
TTCGGGCGCGGCATGTGCATGTACCGCACGGCCAGAACGCGGGAGCTGGTGCTGAAGGGCATCCCCGAGAGCCTGCGGGGGGAGCTGTGGCTCCTCTTC-
-F--G--R--G--M--C--M--Y--R--T--A--R--T--R--E--L--V--L--K--G--I--P--E--S--L--R--G--E--L--W--L--L--F--

--><------------------------------------------------------------------------------------------------
S--G--A--W--N--E--M--V--T--H--P--G--Y--Y--A--E--L--V--E--K--S--T--G--K--Y--S--L--A--T--E--E--I--E--R
CCGGGGCCTGGAATGAGATGGTGACTCACCCCGGGTACTATGCTGAGCTGGTGGAGAAGTCCACCGGGAAGTACAGCCTGGCCACAGAGGAGATCGAGCG
     :::::::::::::::::::::::.::.:: :::::.:::::::::::::::::::::::.:::::::::::::::::::::::::::::::::::
-----GCCTGGAATGAGATGGTGACTCATCCTGGCTACTACGCTGAGCTGGTGGAGAAGTCCACTGGGAAGTACAGCCTGGCCACAGAGGAGATCGAGCG
------A--W--N--E--M--V--T--H--P--G--Y--Y--A--E--L--V--E--K--S--T--G--K--Y--S--L--A--T--E--E--I--E--R

----------------------------------------------------------------------------------------------------
--D--L--H--R--S--M--P--E--H--P--A--F--Q--N--E--L--G--I--A--A--L--R--R--V--L--T--A--Y--A--F--R--N--P-
AGACCTGCACCGCTCCATGCCCGAGCACCCTGCCTTCCAGAACGAGCTGGGGATTGCTGCCCTCCGGCGGGTGCTGACTGCCTATGCCTTCCGAAACCCC
:::::: ::::::::::::::.::::::::.:::::::::::::::::::::::.::::: ::::: :::::::::::.:::::.::.::::::::::::
AGACCTCCACCGCTCCATGCCTGAGCACCCCGCCTTCCAGAACGAGCTGGGGATCGCTGCACTCCGCCGGGTGCTGACCGCCTACGCTTTCCGAAACCCC
--D--L--H--R--S--M--P--E--H--P--A--F--Q--N--E--L--G--I--A--A--L--R--R--V--L--T--A--Y--A--F--R--N--P-

-----------------><---------------------------------------------------------------------------------
-T--I--G--Y--C--Q--A--M--N--I--V--T--S--V--L--L--L--Y--G--S--E--E--E--A--F--W--L--L--V--A--L--C--E--
ACCATCGGCTACTGCCAGGCAATGAACATCGTGACCTCGGTGCTCCTGCTCTATGGCAGTGAGGAGGAGGCCTTCTGGCTCCTGGTGGCCCTGTGCGAGC
:::::::::::::::::::: ::::::::::: :::::.::::::::::::::::::::.:::::::::::::::::::: ::::::::.:: ::.::::
ACCATCGGCTACTGCCAGGCCATGAACATCGTCACCTCAGTGCTCCTGCTCTATGGCAGCGAGGAGGAGGCCTTCTGGCTGCTGGTGGCTCTCTGTGAGC
-T--I--G--Y--C--Q--A--M--N--I--V--T--S--V--L--L--L--Y--G--S--E--E--E--A--F--W--L--L--V--A--L--C--E--

-----------------------------------><---------------------------------------------------------------
R--M--L--P--D--Y--Y--N--T--R--V--V--G--A--L--V--D--Q--G--I--F--E--E--L--T--R--D--F--L--P--Q--L--S--E
GCATGCTGCCCGACTACTACAACACCAGGGTGGTGGGAGCCCTGGTGGACCAAGGCATCTTCGAAGAGCTCACGAGAGACTTCCTGCCGCAGCTCTCGGA
:::::::::::::::::::::::::::::::::::   ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: ::
GCATGCTGCCCGACTACTACAACACCAGGGTGGTG---GCCCTGGTGGACCAAGGCATCTTCGAAGAGCTCACGAGAGACTTCCTGCCGCAGCTCTCTGA
R--M--L--P--D--Y--Y--N--T--R--V--V-----A--L--V--D--Q--G--I--F--E--E--L--T--R--D--F--L--P--Q--L--S--E

----------------------------------------------------------------------------------------------------
--K--M--Q--D--L--G--V--I--S--S--I--S--L--S--W--F--L--T--L--F--L--S--V--M--P--F--E--S--A--V--V--I--V-
GAAGATGCAGGACCTGGGGGTGATCTCCAGCATCTCGCTGTCCTGGTTCCTGACCCTCTTCCTCAGCGTCATGCCCTTCGAGAGCGCCGTGGTCATCGTC
:::::::::::::::::: :::::.:::::::::::.:: ::::::::::::::::::::::::::::::::::::::.::::::::.::::::::.::.
GAAGATGCAGGACCTGGGCGTGATTTCCAGCATCTCACTCTCCTGGTTCCTGACCCTCTTCCTCAGCGTCATGCCCTTTGAGAGCGCTGTGGTCATTGTT
--K--M--Q--D--L--G--V--I--S--S--I--S--L--S--W--F--L--T--L--F--L--S--V--M--P--F--E--S--A--V--V--I--V-

----------------------------------------------------------------------------------------------------
-D--C--F--F--Y--E--G--I--K--V--I--L--Q--V--A--L--A--V--L--D--A--N--M--E--Q--L--L--G--C--S--D--E--G--
GACTGCTTTTTCTATGAGGGCATCAAGGTGATCCTGCAGGTGGCCCTGGCCGTCCTGGACGCCAACATGGAGCAGCTGCTGGGCTGCAGCGACGAGGGCG
::::::::.::::::::::::::::::::::::::::::::::::.:::::.:.:::::.::::::::::::::::::::::::::::::::::::::::
GACTGCTTCTTCTATGAGGGCATCAAGGTGATCCTGCAGGTGGCCTTGGCCATTCTGGATGCCAACATGGAGCAGCTGCTGGGCTGCAGCGACGAGGGCG
-D--C--F--F--Y--E--G--I--K--V--I--L--Q--V--A--L--A--I--L--D--A--N--M--E--Q--L--L--G--C--S--D--E--G--

---------------------><-----------------------------------------------------------------------------
E--A--M--T--M--L--G--R--Y--L--D--N--V--V--N--K--Q--S--V--S--P--P--I--P--H--L--R--A--L--L--S--S--S--D
AGGCCATGACCATGCTGGGCAGATACCTGGATAATGTGGTCAACAAGCAGAGTGTCTCTCCTCCTATCCCGCACCTCCGTGCCTTGCTGAGCAGCAGCGA
:::::::::::.: ::::::   ::::::::::::::::::::.::::::::.:::::::::::.::::: :::::::.::::.:::::: ::::.: ::
AGGCCATGACCGTCCTGGGC---TACCTGGATAATGTGGTCAATAAGCAGAGCGTCTCTCCTCCCATCCCCCACCTCCATGCCCTGCTGACCAGCGGGGA
E--A--M--T--V--L--G-----Y--L--D--N--V--V--N--K--Q--S--V--S--P--P--I--P--H--L--H--A--L--L--T--S--G--D

---------------------------------------------------><-----------------------------------------------
--D--P--P--A--E--V--D--I--F--E--L--L--K--V--S--Y--E--K--F--S--S--L--R--A--E--D--I--E--Q--M--R--F--K-
TGACCCCCCTGCAGAGGTGGACATCTTTGAGCTCCTGAAAGTGTCCTATGAGAAATTCAGCAGCCTGAGGGCCGAAGACATTGAGCAGATGCGGTTTAAA
..: ::.:::: :::::::::::::::.:: ::::::::.::::: :::::::::::::::::::::::::::::.::::::::.:::::::::::::::
CAAGCCTCCTGAAGAGGTGGACATCTTCGACCTCCTGAAGGTGTCGTATGAGAAATTCAGCAGCCTGAGGGCCGAGGACATTGAACAGATGCGGTTTAAA
--K--P--P--E--E--V--D--I--F--D--L--L--K--V--S--Y--E--K--F--S--S--L--R--A--E--D--I--E--Q--M--R--F--K-

--------------------------------------------------><------------------------------------------------
-Q--R--L--K--V--I--Q--S--L--E--D--T--A--K--R--S--V--V--R--A--I--P--V--D--I--G--F--S--I--E--E--L--E--
CAGAGGCTGAAAGTGATCCAGTCCTTGGAGGACACGGCCAAGAGGAGTGTGGTCCGAGCTATACCTGTGGACATTGGTTTCTCCATTGAAGAGCTGGAGG
::: :::::::::: :::::::::::::::::.:::::::::::::::::::::::::::::::::: ::::::.:::::::: ::::::::::::::::
CAGCGGCTGAAAGTCATCCAGTCCTTGGAGGATACGGCCAAGAGGAGTGTGGTCCGAGCTATACCTGGGGACATCGGTTTCTCAATTGAAGAGCTGGAGG
-Q--R--L--K--V--I--Q--S--L--E--D--T--A--K--R--S--V--V--R--A--I--P--G--D--I--G--F--S--I--E--E--L--E--

-------------------><-------------------------------------------------------------------------------
D--L--Y--M--V--F--K--A--K--H--L--A--S--Q--Y--W--G--C--S--R--T--M--A--G--R--R--D--P--S--L--P--Y--L--E
ACCTTTACATGGTGTTTAAGGCCAAGCACCTGGCTAGCCAGTACTGGGGGTGCAGCCGCACAATGGCCGGCCGTCGGGACCCCAGCCTGCCCTACCTGGA
:::::::::::::::::::::::::::::::::: ::.:::::::::::: :::::::: : ...::.:  :::::::::::::::::::::::::::::
ACCTTTACATGGTGTTTAAGGCCAAGCACCTGGCGAGTCAGTACTGGGGGAGCAGCCGCCCTGCAGCTGTGCGTCGGGACCCCAGCCTGCCCTACCTGGA
D--L--Y--M--V--F--K--A--K--H--L--A--S--Q--Y--W--G--S--S--R--P--A--A--V--R--R--D--P--S--L--P--Y--L--E

----------------------------------------------------------------------------------------------------
--Q--Y--R--I--D--A--S--Q--F--R--E--L--F--A--S--L--T--P--W--A--C--G--S--H--T--P--L--L--A--G--R--M--F-
GCAGTACCGGATTGATGCCAGCCAGTTCCGGGAACTCTTTGCCAGCCTGACACCCTGGGCCTGTGGCTCCCACACACCTCTGCTGGCAGGGCGCATGTTC
::::::::: ::.::.:. :.::::::::.:::::::::::::::.:::::.::::::::.:::::::::::::::::. :::::::.::.::::::::.
GCAGTACCGCATCGACGTGAACCAGTTCCAGGAACTCTTTGCCAGTCTGACGCCCTGGGCTTGTGGCTCCCACACACCCGTGCTGGCGGGACGCATGTTT
--Q--Y--R--I--D--V--N--Q--F--Q--E--L--F--A--S--L--T--P--W--A--C--G--S--H--T--P--V--L--A--G--R--M--F-

------------------------------------------------------------><--------------------------------------
-R--L--L--D--E--N--K--D--S--L--I--N--F--K--E--F--V--T--G--M--S--G--M--Y--H--G--D--L--T--E--K--L--K--
AGGCTCCTGGACGAAAACAAGGACTCGCTGATCAACTTCAAGGAGTTCGTGACAGGGATGAGCGGGATGTACCACGGGGACCTGACAGAGAAGCTCAAGG
 ::::::::::.:::::.::::::::::::::::::::::::::::::::::::::::::   ::::::::::::::.::::::::::::::.:::::::
CGGCTCCTGGATGAAAATAAGGACTCGCTGATCAACTTCAAGGAGTTCGTGACAGGGATG---GGGATGTACCACGGAGACCTGACAGAGAAACTCAAGG
-R--L--L--D--E--N--K--D--S--L--I--N--F--K--E--F--V--T--G--M-----G--M--Y--H--G--D--L--T--E--K--L--K--

--------------------------><----------------------------------------------------------------------><
V--L--Y--K--L--H--L--P--P--A--L--S--P--E--E--A--E--S--A--L--E--A--A--H--Y--F--T--E--D--S--S--S--E--A
TGCTCTACAAGCTACACCTTCCCCCAGCTCTGAGCCCAGAGGAAGCCGAGTCAGCCCTGGAGGCGGCCCATTATTTCACAGAGGACAGCTCCTCAGAAGC
:::::::::::::.:::.: ::.:::   ::::::::::::::.:::::::::::::::::.:::.::::::::::::: ::::::::::::::::::  
TGCTCTACAAGCTGCACTTGCCTCCA---CTGAGCCCAGAGGAGGCCGAGTCAGCCCTGGAAGCGACCCATTATTTCACCGAGGACAGCTCCTCAGAA--
V--L--Y--K--L--H--L--P--P-----L--S--P--E--E--A--E--S--A--L--E--A--T--H--Y--F--T--E--D--S--S--S--E---

-------------------------------------------------><-------------------------------------------------
--S--P--L--A--S--D--L--D--L--F--L--P--W--E--A--Q--E--A--L--P--Q--E--E--Q--E--G--S--G--S--E--E--R--G-
ATCTCCTCTGGCCTCAGATCTGGATCTTTTCCTGCCCTGGGAGGCTCAAGAAGCACTACCACAGGAAGAGCAAGAAGGAAGTGGAAGTGAGGAGAGAGGA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

><--------------------------------------------------------------------------------------------------
-E--E--K--G--T--S--S--P--D--Y--R--H--Y--L--R--M--W--A--K--E--K--E--A--Q--K--E--T--I--K--D--L--P--K--
GAGGAGAAGGGGACCAGCTCTCCGGACTATCGGCACTACCTTCGAATGTGGGCCAAGGAGAAAGAGGCTCAGAAGGAGACGATTAAGGATCTTCCCAAGA
   :::::::::::::::.:::: ::::::::.::::::::::::::::::::::::::::::::::..:::::::::::::::::::::::::::::::
---GAGAAGGGGACCAGCCCTCCCGACTATCGACACTACCTTCGAATGTGGGCCAAGGAGAAAGAGGTCCAGAAGGAGACGATTAAGGATCTTCCCAAGA
----E--K--G--T--S--P--P--D--Y--R--H--Y--L--R--M--W--A--K--E--K--E--V--Q--K--E--T--I--K--D--L--P--K--

-------><-------------------------------------------------------------------------------------------
M--N--Q--E--Q--F--I--E--L--C--K--T--L--Y--N--M--F--S--E--D--P--M--E--Q--D--L--Y--H--A--I--A--T--V--A
TGAACCAGGAGCAGTTCATTGAGCTGTGCAAGACGCTTTACAACATGTTCAGTGAAGACCCCATGGAGCAGGACCTGTACCACGCCATCGCCACCGTGGC
::::::::::::::::::::::::::::::::::.:::::::::::::::::::::::::::::::::::::::.::::::::::::::::::: :::::
TGAACCAGGAGCAGTTCATTGAGCTGTGCAAGACACTTTACAACATGTTCAGTGAAGACCCCATGGAGCAGGACTTGTACCACGCCATCGCCACGGTGGC
M--N--Q--E--Q--F--I--E--L--C--K--T--L--Y--N--M--F--S--E--D--P--M--E--Q--D--L--Y--H--A--I--A--T--V--A

----------------------------------------------------------------------------------------------------
--S--L--L--L--R--I--G--E--V--G--K--K--F--S--A--R--T--G--R--K--P--R--D--C--A--T--E--E--D--E--P--P--A-
CAGCCTCCTGCTCCGCATCGGAGAGGTGGGGAAGAAGTTCTCAGCCCGCACAGGCAGGAAGCCCAGGGACTGTGCCACTGAGGAGGACGAGCCACCAGCA
:::::: ::::::::::::::.:::::::::::::.:::.:: :: ::  ::::::::::::::::::::  .::: :::::::::::::::..::::: 
CAGCCTGCTGCTCCGCATCGGGGAGGTGGGGAAGAGGTTTTCCGCACGGCCAGGCAGGAAGCCCAGGGACATCGCCCCTGAGGAGGACGAGCTGCCAGCC
--S--L--L--L--R--I--G--E--V--G--K--R--F--S--A--R--P--G--R--K--P--R--D--I--A--P--E--E--D--E--L--P--A-

----------------------------------------------------------------------------------------------------
-P--E--L--H--Q--D--A--A--R--E--L--Q--P--P--A--A--G--D--P--Q--A--K--A--G--G--D--T--H--L--G--K--A--P--
CCCGAACTGCATCAGGACGCAGCCAGGGAGCTTCAGCCCCCAGCTGCAGGAGACCCCCAAGCCAAAGCAGGCGGAGACACACACCTCGGAAAAGCCCCAC
:: :: :: : ::::.:: :.::: ::::::::::::: :: ::::::::.::::::::.::::::::.::.:::::::: ::::..::.::::::::.:
CCAGACCTCCCTCAGAACCCGGCCCGGGAGCTTCAGCCGCCTGCTGCAGGGGACCCCCAGGCCAAAGCGGGTGGAGACACCCACCCTGGGAAAGCCCCGC
-P--D--L--P--Q--N--P--A--R--E--L--Q--P--P--A--A--G--D--P--Q--A--K--A--G--G--D--T--H--P--G--K--A--P--

----------------------------------------------------------------------------------------------------
Q--E--S--Q--V--V--V--E--G--G--S--G--E--G--Q--G--S--P--S--Q--L--L--S--D--D--E--T--K--D--D--M--S--M--S
AGGAGAGCCAGGTGGTGGTGGAGGGGGGCAGCGGCGAGGGACAGGGCTCACCCTCCCAGCTGCTGTCTGACGATGAAACCAAAGACGACATGTCCATGTC
::::::::::::::::::  ::.::::::.::::.::::: :.:::::: ::::::::::. ::::: :::::::::::::::::.::: ::::::::::
AGGAGAGCCAGGTGGTGGGCGAAGGGGGCGGCGGTGAGGGCCGGGGCTCCCCCTCCCAGCCTCTGTCGGACGATGAAACCAAAGATGACCTGTCCATGTC
Q--E--S--Q--V--V--G--E--G--G--G--G--E--G--R--G--S--P--S--Q--P--L--S--D--D--E--T--K--D--D--L--S--M--S

----------------------------------------------------------------------------------------------------
--S--Y--S--V--V--S--T--G--S--L--Q--C--E--D--L--A--D--D--T--V--L--V--G--G--E--A--C--S--P--------T--A-
CTCCTACTCGGTGGTCAGCACGGGCTCCCTGCAATGTGAAGACCTTGCAGACGACACGGTGCTGGTGGGCGGGGAGGCCTGCAGCCCC------ACAGCG
:::::::::::::::::::::::::::::::::.:::::.::::: :: ::::::::.:::::::::::::::::::::.::::::::      ::  : 
CTCCTACTCGGTGGTCAGCACGGGCTCCCTGCAGTGTGAGGACCTGGCTGACGACACAGTGCTGGTGGGCGGGGAGGCCCGCAGCCCCGTGACCACCCCC
--S--Y--S--V--V--S--T--G--S--L--Q--C--E--D--L--A--D--D--T--V--L--V--G--G--E--A--R--S--P--V--T--T--P-

----------------------------------------------------------------------------------------------------
-R--I--G--G--T--V--D--T--D--W--C--I--S--F--E--Q--I--L--A--S--I--L--T--E--S--V--L--V--N--F--F--E--K--
CGCATCGGCGGCACCGTCGACACCGACTGGTGCATCTCCTTTGAGCAGATCCTGGCCTCCATCCTGACGGAGTCCGTGCTGGTGAACTTCTTTGAGAAGA
:.:  .:: :::::::: ::::: :::::: ::::::::::.::::::::::::::::::::::::::::::::.:::::::::::::::.:::::::::
CACTGTGGGGGCACCGTGGACACAGACTGGAGCATCTCCTTCGAGCAGATCCTGGCCTCCATCCTGACGGAGTCTGTGCTGGTGAACTTCCTTGAGAAGA
-H--C--G--G--T--V--D--T--D--W--S--I--S--F--E--Q--I--L--A--S--I--L--T--E--S--V--L--V--N--F--L--E--K--

---------------------------------------------------------------------------------------------->
R--V--D--I--G--L--K--I--K--D--Q--K--K--V--E--R--Q--F--S--T--A--S--D--H--E--Q--P--G--V--S--G--*-
GAGTGGACATTGGACTCAAGATCAAGGACCAAAAGAAAGTGGAGAGACAGTTCAGCACCGCCAGTGACCATGAGCAGCCTGGAGTTTCCGGCTGA
..::.:::::::::::::::::::::::::::::::::::::::::::::::.:::::: :::::::::::::::::.::: ::.::. ::::::
AGGTAGACATTGGACTCAAGATCAAGGACCAAAAGAAAGTGGAGAGACAGTTTAGCACCTCCAGTGACCATGAGCAGTCTGCAGCTTTGGGCTGA
K--V--D--I--G--L--K--I--K--D--Q--K--K--V--E--R--Q--F--S--T--S--S--D--H--E--Q--S--A--A--L--G--*-

Pig Consensus Sequence

>BGISUST0000894242
------CCTCGGCCCTGTGCGAGCGGTCGCACGATGTGGCTGGGCCCGGAGGAGGTGCTGGTGGCCAACGCGCTGTGGGTGACGGAGCGGGCCAACCCCT
TCTTTGTGCTGCAGCGGCGCCGGGGCCACGGCAAGGGCGGCGGGCTCACG---CTTCTCGTGGGCACCTTGGACGTGGTGCTGGACTCTAGCGCCCGGGT
GGCCCCTTACCGTATCCTGCACCAGACCCAGGACTCTCAGGTCTACTGGACAGTGGCA------TCTTCCCGCAAAGAAATCACAAAACACTGGGAATGG
CTGGAAAACAACTTACTTCAGAATCTGTCCATCTTTGACAATGAGGAGGATATTACCACGATCGTCAAGGGCAAGATA---GGCATCATCGCAGAAGAGA
ACAAGAACCTGCAGCCCCAGGGAGACGAGGACCCTGGGAAGTTCAAGGAGGCCGAGCTGAAGATGCGGAAGCAGTTTGGGATGCCCGAGGGGGAGAAGCT
GGTCAACTACTACTCCTGCAGCTACTGGAAGGGCCATGTGCCCCGGCAGGGCTGGCTCTACCTGACTGTCAACCACCTGTGTTTCTACTCCTTCCTGCTG
GGCAAG------AGCCTGGTGGTGCGGTGGGTGGACGTCACACGGCTGGAGAAGAACGCCACACTGCTGTTCCCTGAGAGCATCCGGGTGGACACCCGGG
ACCAGGAGCTCTTCTTCTCCATGTTCCTCAACATCACTGAGACCTTCAAGCTCATGGAGCAGCTGGCTAACCTGGCCATGCGGCAGCTGCTGGACAGCGA
GGGCTTCCTGGAGGACAAGGCGCTGCCCAGGCCCCCCCAGCCGCACAAGAAAATTTCGGCTCTG------------------------------------
----------------------------------------------------------------------------------------------------
-----------------------------------------------------------------------------GTGACCATTGTCGAAAAAGCTGA
CAGCTCTGGTGTCCTGCCCAGCCCTCTGTCCATTAGCACCAAGAGCAAAATGACCTTCCTGTTCGCCAACCTGAAAGACCGAGATTTCTTGGTTCAGAGG
ATCTCCGACTTCCTCCAGAAAATGCCGTCCAAGCAGCCGGGCAGCAGCAGAGCAGCAAGGAAAACCAGCATTGCAGACCCAGCCCCA-------------
----------------------------------------------------------------------------------------------------
-------------------------------------------------------------------------------------------TTTGAGTTC
GGGCGCGGCATGTGCATGTACCGCACGGCCAGAACGCGGGAGCTGGTGCTGAAGGGCATCCCCGAGAGCCTGCGGGGGGAGCTGTGGCTCCTCTTC----
--GCCTGGAATGAGATGGTGACTCATCCTGGCTACTACGCTGAGCTGGTGGAGAAGTCCACTGGGAAGTACAGCCTGGCCACAGAGGAGATCGAGCGAGA
CCTCCACCGCTCCATGCCTGAGCACCCCGCCTTCCAGAACGAGCTGGGGATCGCTGCACTCCGCCGGGTGCTGACCGCCTACGCTTTCCGAAACCCCACC
ATCGGCTACTGCCAGGCCATGAACATCGTCACCTCAGTGCTCCTGCTCTATGGCAGCGAGGAGGAGGCCTTCTGGCTGCTGGTGGCTCTCTGTGAGCGCA
TGCTGCCCGACTACTACAACACCAGGGTGGTG---GCCCTGGTGGACCAAGGCATCTTCGAAGAGCTCACGAGAGACTTCCTGCCGCAGCTCTCTGAGAA
GATGCAGGACCTGGGCGTGATTTCCAGCATCTCACTCTCCTGGTTCCTGACCCTCTTCCTCAGCGTCATGCCCTTTGAGAGCGCTGTGGTCATTGTTGAC
TGCTTCTTCTATGAGGGCATCAAGGTGATCCTGCAGGTGGCCTTGGCCATTCTGGATGCCAACATGGAGCAGCTGCTGGGCTGCAGCGACGAGGGCGAGG
CCATGACCGTCCTGGGC---TACCTGGATAATGTGGTCAATAAGCAGAGCGTCTCTCCTCCCATCCCCCACCTCCATGCCCTGCTGACCAGCGGGGACAA
GCCTCCTGAAGAGGTGGACATCTTCGACCTCCTGAAGGTGTCGTATGAGAAATTCAGCAGCCTGAGGGCCGAGGACATTGAACAGATGCGGTTTAAACAG
CGGCTGAAAGTCATCCAGTCCTTGGAGGATACGGCCAAGAGGAGTGTGGTCCGAGCTATACCTGGGGACATCGGTTTCTCAATTGAAGAGCTGGAGGACC
TTTACATGGTGTTTAAGGCCAAGCACCTGGCGAGTCAGTACTGGGGGAGCAGCCGCCCTGCAGCTGTGCGTCGGGACCCCAGCCTGCCCTACCTGGAGCA
GTACCGCATCGACGTGAACCAGTTCCAGGAACTCTTTGCCAGTCTGACGCCCTGGGCTTGTGGCTCCCACACACCCGTGCTGGCGGGACGCATGTTTCGG
CTCCTGGATGAAAATAAGGACTCGCTGATCAACTTCAAGGAGTTCGTGACAGGGATG---GGGATGTACCACGGAGACCTGACAGAGAAACTCAAGGTGC
TCTACAAGCTGCACTTGCCTCCA---CTGAGCCCAGAGGAGGCCGAGTCAGCCCTGGAAGCGACCCATTATTTCACCGAGGACAGCTCCTCAGAA-----
----------------------------------------------------------------------------------------------------
GAGAAGGGGACCAGCCCTCCCGACTATCGACACTACCTTCGAATGTGGGCCAAGGAGAAAGAGGTCCAGAAGGAGACGATTAAGGATCTTCCCAAGATGA
ACCAGGAGCAGTTCATTGAGCTGTGCAAGACACTTTACAACATGTTCAGTGAAGACCCCATGGAGCAGGACTTGTACCACGCCATCGCCACGGTGGCCAG
CCTGCTGCTCCGCATCGGGGAGGTGGGGAAGAGGTTTTCCGCACGGCCAGGCAGGAAGCCCAGGGACATCGCCCCTGAGGAGGACGAGCTGCCAGCCCCA
GACCTCCCTCAGAACCCGGCCCGGGAGCTTCAGCCGCCTGCTGCAGGGGACCCCCAGGCCAAAGCGGGTGGAGACACCCACCCTGGGAAAGCCCCGCAGG
AGAGCCAGGTGGTGGGCGAAGGGGGCGGCGGTGAGGGCCGGGGCTCCCCCTCCCAGCCTCTGTCGGACGATGAAACCAAAGATGACCTGTCCATGTCCTC
CTACTCGGTGGTCAGCACGGGCTCCCTGCAGTGTGAGGACCTGGCTGACGACACAGTGCTGGTGGGCGGGGAGGCCCGCAGCCCCGTGACCACCCCCCAC
TGTGGGGGCACCGTGGACACAGACTGGAGCATCTCCTTCGAGCAGATCCTGGCCTCCATCCTGACGGAGTCTGTGCTGGTGAACTTCCTTGAGAAGAAGG
TAGACATTGGACTCAAGATCAAGGACCAAAAGAAAGTGGAGAGACAGTTTAGCACCTCCAGTGACCATGAGCAGTCTGCAGCTTTG


>BGISUSP0000894242
--PRPCASGRTMWLGPEEVLVANALWVTERANPFFVLQRRRGHGKGGGLT-LLVGTLDVVLDSSARVAPYRILHQTQDSQVYWTVA--SSRKEITKHWEW
LENNLLQNLSIFDNEEDITTIVKGKI-GIIAEENKNLQPQGDEDPGKFKEAELKMRKQFGMPEGEKLVNYYSCSYWKGHVPRQGWLYLTVNHLCFYSFLL
GK--SLVVRWVDVTRLEKNATLLFPESIRVDTRDQELFFSMFLNITETFKLMEQLANLAMRQLLDSEGFLEDKALPRPPQPHKKISAL------------
-----------------------------------------------------------VTIVEKADSSGVLPSPLSISTKSKMTFLFANLKDRDFLVQR
ISDFLQKMPSKQPGSSRAARKTSIADPAP--------------------------------------------------------------------FEF
GRGMCMYRTARTRELVLKGIPESLRGELWLLF--AWNEMVTHPGYYAELVEKSTGKYSLATEEIERDLHRSMPEHPAFQNELGIAALRRVLTAYAFRNPT
IGYCQAMNIVTSVLLLYGSEEEAFWLLVALCERMLPDYYNTRVV-ALVDQGIFEELTRDFLPQLSEKMQDLGVISSISLSWFLTLFLSVMPFESAVVIVD
CFFYEGIKVILQVALAILDANMEQLLGCSDEGEAMTVLG-YLDNVVNKQSVSPPIPHLHALLTSGDKPPEEVDIFDLLKVSYEKFSSLRAEDIEQMRFKQ
RLKVIQSLEDTAKRSVVRAIPGDIGFSIEELEDLYMVFKAKHLASQYWGSSRPAAVRRDPSLPYLEQYRIDVNQFQELFASLTPWACGSHTPVLAGRMFR
LLDENKDSLINFKEFVTGM-GMYHGDLTEKLKVLYKLHLPP-LSPEEAESALEATHYFTEDSSSE-----------------------------------
EKGTSPPDYRHYLRMWAKEKEVQKETIKDLPKMNQEQFIELCKTLYNMFSEDPMEQDLYHAIATVASLLLRIGEVGKRFSARPGRKPRDIAPEEDELPAP
DLPQNPARELQPPAAGDPQAKAGGDTHPGKAPQESQVVGEGGGGEGRGSPSQPLSDDETKDDLSMSSYSVVSTGSLQCEDLADDTVLVGGEARSPVTTPH
CGGTVDTDWSISFEQILASILTESVLVNFLEKKVDIGLKIKDQKKVERQFSTSSDHEQSAAL