Sequences
EST Library Info
pgl6Pituitary gland
ret4Retina
tes5Testes
Clusters
Oligos
SNPs

Gene ID ENSG00000153956 (click for geneview)
Transcript ID ENST00000356860(link to ensembl)
Symbol CACNA2D1
Localtion Chromosome:7:81224069:81717456:-1 band: 7q21.11
Description Dihydropyridine-sensitive L-type, calcium channel alpha-2/delta subunits precursor. [Source:Uniprot/SWISSPROT;Acc:P54289]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------><----
-M--A--A--G--C--L--L--A--L--T--L--T--L--F--Q--S--L--L--I--G--P--S--S--E--E--P--F--P--S--A--V--T--I--
ATGGCTGCTGGCTGCCTGCTGGCCTTGACTCTGACACTTTTCCAATCTTTGCTCATCGGCCCCTCGTCGGAGGAGCCGTTCCCTTCGGCCGTCACTATCA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------><----------------------
K--S--W--V--D--K--M--Q--E--D--L--V--T--L--A--K--T--A--S--G--V--N--Q--L--V--D--I--Y--E--K--Y--Q--D--L
AATCATGGGTGGATAAGATGCAAGAAGACCTTGTCACACTGGCAAAAACAGCAAGTGGAGTCAATCAGCTTGTTGATATTTATGAGAAATATCAAGATTT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

---------------------------------------------------------------------------------------------><-----
--Y--T--V--E--P--N--N--A--R--Q--L--V--E--I--A--A--R--D--I--E--K--L--L--S--N--R--S--K--A--L--V--R--L-
GTATACTGTGGAACCAAATAATGCACGCCAGCTGGTAGAAATTGCAGCCAGGGATATTGAGAAACTTCTGAGCAACAGATCTAAAGCCCTGGTGCGCCTG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-----------------------------------------------------><----------------------------------------><---
-A--L--E--A--E--K--V--Q--A--A--H--Q--W--R--E--D--F--A--S--N--E--V--V--Y--Y--N--A--K--D--D--L--D--P--
GCATTGGAAGCGGAGAAAGTTCAAGCAGCTCACCAGTGGAGAGAAGATTTTGCAAGCAATGAAGTTGTCTACTACAATGCAAAGGATGATCTCGATCCTG
                                                                                                ::::
------------------------------------------------------------------------------------------------CCTG
-------------------------------------------------------------------------------------------------P--

----------------------------------------------------------------------------------------------------
E--K--N--D--S--E--P--G--S--Q--R--I--K--P--V--F--I--E--D--A--N--F--G--R--Q--I--S--Y--Q--H--A--A--V--H
AGAAAAATGACAGTGAGCCAGGCAGCCAGAGGATAAAACCTGTTTTCATTGAAGATGCTAATTTTGGACGACAAATATCTTATCAGCACGCAGCAGTCCA
:.:::::::::::::::::::::::::::::::::::::  :::::.::::: ::::::::::::::.:::::.::::::::::::::.:::::::::::
AAAAAAATGACAGTGAGCCAGGCAGCCAGAGGATAAAACGGGTTTTTATTGATGATGCTAATTTTGGGCGACAGATATCTTATCAGCATGCAGCAGTCCA
E--K--N--D--S--E--P--G--S--Q--R--I--K--R--V--F--I--D--D--A--N--F--G--R--Q--I--S--Y--Q--H--A--A--V--H

-------------------------><-------------------------------------------------------------------------
--I--P--T--D--I--Y--E--G--S--T--I--V--L--N--E--L--N--W--T--S--A--L--D--E--V--F--K--K--N--R--E--E--D-
TATTCCTACTGACATCTATGAGGGCTCAACAATTGTGTTAAATGAACTCAACTGGACAAGTGCCTTAGATGAAGTTTTCAAAAAGAATCGCGAGGAAGAC
::::::.::.:::::::::::::::   :::::::::::::::::::: ::::::::::::::::::::::::::::::::.::.::::: ::::::::.
TATTCCCACCGACATCTATGAGGGC---ACAATTGTGTTAAATGAACTGAACTGGACAAGTGCCTTAGATGAAGTTTTCAAGAAAAATCGAGAGGAAGAT
--I--P--T--D--I--Y--E--G-----T--I--V--L--N--E--L--N--W--T--S--A--L--D--E--V--F--K--K--N--R--E--E--D-

---------------------------------------------------------><-----------------------------------------
-P--S--L--L--W--Q--V--F--G--S--A--T--G--L--A--R--Y--Y--P--A--S--P--W--V--D--N--S--R--T--P--N--K--I--
CCTTCATTATTGTGGCAGGTTTTTGGCAGTGCCACTGGCCTAGCTCGATATTATCCAGCTTCACCATGGGTTGATAATAGTAGAACTCCAAATAAGATTG
::.::::::::::::::::: :::::::::::::: :::::.::.::.:::::::::   :: ::::::::::::::.::::::::::::::.:::::::
CCCTCATTATTGTGGCAGGTGTTTGGCAGTGCCACAGGCCTGGCCCGGTATTATCCA---TCTCCATGGGTTGATAACAGTAGAACTCCAAACAAGATTG
-P--S--L--L--W--Q--V--F--G--S--A--T--G--L--A--R--Y--Y--P-----S--P--W--V--D--N--S--R--T--P--N--K--I--

---------------------------><-------------------------------------------------><--------------------
D--L--Y--D--V--R--R--R--P--W--Y--I--Q--G--A--A--S--P--K--D--M--L--I--L--V--D--V--S--G--S--V--S--G--L
ACCTTTATGATGTACGCAGAAGACCATGGTACATCCAAGGAGCTGCATCTCCTAAAGACATGCTTATTCTGGTGGATGTGAGTGGAAGTGTTAGTGGATT
:::::::::::::::: ::.::::::   :::::::::::::::::::::::::::::.::::::::::::::       ::::::::::::::::: ::
ACCTTTATGATGTACGAAGGAGACCA---TACATCCAAGGAGCTGCATCTCCTAAAGATATGCTTATTCTGGTC------AGTGGAAGTGTTAGTGGTTT
D--L--Y--D--V--R--R--R--P-----Y--I--Q--G--A--A--S--P--K--D--M--L--I--L--V--------S--G--S--V--S--G--L

------------------------------------------------------------------------------><--------------------
--T--L--K--L--I--R--T--S--V--S--E--M--L--E--T--L--S--D--D--D--F--V--N--V--A--S--F--N--S--N--A--Q--D-
GACACTTAAACTGATCCGAACATCTGTCTCCGAAATGTTAGAAACCCTCTCAGATGATGATTTCGTGAATGTAGCTTCATTTAACAGCAATGCTCAGGAT
:::.::::::::::::::::::::::::::.::::::::.:::::::::::::::::.:::::.:::::::::::::::::::::::::::::.::::::
GACGCTTAAACTGATCCGAACATCTGTCTCTGAAATGTTGGAAACCCTCTCAGATGACGATTTTGTGAATGTAGCTTCATTTAACAGCAATGCCCAGGAT
--T--L--K--L--I--R--T--S--V--S--E--M--L--E--T--L--S--D--D--D--F--V--N--V--A--S--F--N--S--N--A--Q--D-

----------------------------------------------------------------------------------------------------
-V--S--C--F--Q--H--L--V--Q--A--N--V--R--N--K--K--V--L--K--D--A--V--N--N--I--T--A--K--G--I--T--D--Y--
GTAAGCTGTTTTCAGCACCTTGTCCAAGCAAATGTAAGAAATAAAAAAGTGTTGAAAGACGCGGTGAATAATATCACAGCCAAAGGAATTACAGATTATA
::::::::::::::.:::::::::::::::::::::::::::::.::::::.:::::::.::.:: :::::::::::::: ::::::::.::::::::.:
GTAAGCTGTTTTCAACACCTTGTCCAAGCAAATGTAAGAAATAAGAAAGTGCTGAAAGATGCAGTTAATAATATCACAGCAAAAGGAATCACAGATTACA
-V--S--C--F--Q--H--L--V--Q--A--N--V--R--N--K--K--V--L--K--D--A--V--N--N--I--T--A--K--G--I--T--D--Y--

-------------------------------------><-------------------------------------------------------------
K--K--G--F--S--F--A--F--E--Q--L--L--N--Y--N--V--S--R--A--N--C--N--K--I--I--M--L--F--T--D--G--G--E--E
AGAAGGGCTTTAGTTTTGCTTTTGAACAGCTGCTTAATTATAATGTTTCCAGAGCAAACTGCAATAAGATTATTATGCTATTCACGGATGGAGGAGAAGA
::::::::::::::::::::::::::::.::::::::::::::.:::::.::::: :::::::::::::::::.:::.:.::::: ::::::::::::::
AGAAGGGCTTTAGTTTTGCTTTTGAACAACTGCTTAATTATAACGTTTCTAGAGCCAACTGCAATAAGATTATCATGTTGTTCACCGATGGAGGAGAAGA
K--K--G--F--S--F--A--F--E--Q--L--L--N--Y--N--V--S--R--A--N--C--N--K--I--I--M--L--F--T--D--G--G--E--E

------------------------------------------><--------------------------------------------------------
--R--A--Q--E--I--F--N--K--Y--N--K--D--K--K--V--R--V--F--T--F--S--V--G--Q--H--N--Y--D--R--G--P--I--Q-
GAGAGCCCAGGAGATATTTAACAAATACAATAAAGATAAAAAAGTACGTGTATTCACGTTTTCAGTTGGTCAACACAATTATGACAGAGGACCTATTCAG
::::::.::::::::::::. :::::::::.:::::.::::::::::::::::::::.:::::::::::::::::.::::::::::::::::::::::::
GAGAGCTCAGGAGATATTTGCCAAATACAACAAAGACAAAAAAGTACGTGTATTCACATTTTCAGTTGGTCAACATAATTATGACAGAGGACCTATTCAG
--R--A--Q--E--I--F--A--K--Y--N--K--D--K--K--V--R--V--F--T--F--S--V--G--Q--H--N--Y--D--R--G--P--I--Q-

---------------------><------------------------------------------------><---------------------------
-W--M--A--C--E--N--K--G--Y--Y--Y--E--I--P--S--I--G--A--I--R--I--N--T--Q--E--Y--L--D--V--L--G--R--P--
TGGATGGCCTGTGAAAACAAAGGTTATTATTATGAAATTCCTTCCATTGGTGCAATAAGAATCAATACTCAGGAATATTTGGATGTTTTGGGAAGACCAA
:::::::::::::::::.:::                                                   :::::::::::::::.::::::::::::
TGGATGGCCTGTGAAAATAAA---------------------------------------------------GAATATTTGGATGTTCTGGGAAGACCAA
-W--M--A--C--E--N--K-----------------------------------------------------E--Y--L--D--V--L--G--R--P--

-------------------------------------------------------------><-------------------------------------
M--V--L--A--G--D--K--A--K--Q--V--Q--W--T--N--V--Y--L--D--A--L--E--L--G--L--V--I--T--G--T--L--P--V--F
TGGTTTTAGCAGGAGACAAAGCTAAGCAAGTCCAATGGACAAATGTGTACCTGGATGCATTGGAACTGGGACTTGTCATTACTGGAACTCTTCCGGTCTT
::::::::::::::::::::::::::::::::::.::::::::.:::::::::::::::.::::::::::::::::::::::::::::::::::::::::
TGGTTTTAGCAGGAGACAAAGCTAAGCAAGTCCAGTGGACAAACGTGTACCTGGATGCACTGGAACTGGGACTTGTCATTACTGGAACTCTTCCGGTCTT
M--V--L--A--G--D--K--A--K--Q--V--Q--W--T--N--V--Y--L--D--A--L--E--L--G--L--V--I--T--G--T--L--P--V--F

---------------------------------------><-----------------------------------------------------------
--N--I--T--G--Q--F--E--N--K--T--N--L--K--N--Q--L--I--L--G--V--M--G--V--D--V--S--L--E--D--I--K--R--L-
CAACATAACCGGCCAATTTGAAAATAAGACAAACTTAAAGAACCAGCTGATTCTTGGTGTGATGGGAGTAGATGTGTCTTTGGAAGATATTAAAAGACTG
::::::::::::::::  ::::::::::::.:::::::::::::::::::::::::::::::::::::: :::::.::::::::::::::::::::::::
CAACATAACCGGCCAAAATGAAAATAAGACGAACTTAAAGAACCAGCTGATTCTTGGTGTGATGGGAGTTGATGTATCTTTGGAAGATATTAAAAGACTG
--N--I--T--G--Q--N--E--N--K--T--N--L--K--N--Q--L--I--L--G--V--M--G--V--D--V--S--L--E--D--I--K--R--L-

--------------><-------------------------------------------------------------------------><---------
-T--P--R--F--T--L--C--P--N--G--Y--Y--F--A--I--D--P--N--G--Y--V--L--L--H--P--N--L--Q--P--K--N--P--K--
ACACCACGTTTTACACTGTGCCCCAATGGGTATTACTTTGCAATCGATCCTAATGGTTATGTTTTATTACATCCAAATCTTCAGCCAAAGAACCCCAAAT
::::::::::::::::::::::::::::: ::::::::::::::.:::::::::::.:::::::::::::::::::::::::::::::::          
ACACCACGTTTTACACTGTGCCCCAATGGCTATTACTTTGCAATTGATCCTAATGGCTATGTTTTATTACATCCAAATCTTCAGCCAAAG----------
-T--P--R--F--T--L--C--P--N--G--Y--Y--F--A--I--D--P--N--G--Y--V--L--L--H--P--N--L--Q--P--K-----------

-------------------------------------------------------------><-------------------------------------
S--Q--E--P--V--T--L--D--F--L--D--A--E--L--E--N--D--I--K--V--E--I--R--N--K--M--I--D--G--E--S--G--E--K
CTCAGGAGCCAGTAACATTGGATTTCCTTGATGCAGAGTTAGAGAATGATATTAAAGTGGAGATTCGAAATAAGATGATTGATGGGGAAAGTGGAGAAAA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

---------------------------------><------------------------------------------------------------><---
--T--F--R--T--L--V--K--S--Q--D--E--R--Y--I--D--K--G--N--R--T--Y--T--W--T--P--V--N--G--T--D--Y--S--L-
AACATTCAGAACTCTGGTTAAATCTCAAGATGAGAGATATATTGACAAAGGAAACAGGACATACACATGGACACCTGTCAATGGCACAGATTACAGTTTG
                                  :::::::::::::::::::::::::::::.:::::::: :::::::::::::::::::::   :::
----------------------------------AGATATATTGACAAAGGAAACAGGACATATACATGGACTCCTGTCAATGGCACAGATTAC---TTG
-----------------------------------R--Y--I--D--K--G--N--R--T--Y--T--W--T--P--V--N--G--T--D--Y-----L-

------------------------------------------------------------------------><-------------------><-----
-A--L--V--L--P--T--Y--S--F--Y--Y--I--K--A--K--L--E--E--T--I--T--Q--A--R--S--K--K--G--K--M--K--D--S--
GCCTTGGTATTACCAACCTACAGTTTTTACTATATAAAAGCCAAACTAGAAGAGACAATAACTCAGGCCAGATCAAAAAAGGGCAAAATGAAGGATTCGG
::::::::::::::::::::::::::::::::::::::::::::: ::::::::::::::::::::::::::                            
GCCTTGGTATTACCAACCTACAGTTTTTACTATATAAAAGCCAAAATAGAAGAGACAATAACTCAGGCCAGA----------------------------
-A--L--V--L--P--T--Y--S--F--Y--Y--I--K--A--K--I--E--E--T--I--T--Q--A--R-----------------------------

------------------------------------------------------><--------------------------------------------
E--T--L--K--P--D--N--F--E--E--S--G--Y--T--F--I--A--P--R--D--Y--C--N--D--L--K--I--S--D--N--N--T--E--F
AAACCCTGAAGCCAGATAATTTTGAAGAATCTGGCTATACATTCATAGCACCAAGAGATTACTGCAATGACCTGAAAATATCGGATAATAACACTGAATT
                                                        ::.:::::::::::::: ::::::::.::::::::.::.:::::
--------------------------------------------------------GACTACTGCAATGACCTTAAAATATCAGATAATAATACCGAATT
---------------------------------------------------------D--Y--C--N--D--L--K--I--S--D--N--N--T--E--F

----------------------------------------------------><----------------------------------------------
--L--L--N--F--N--E--F--I--D--R--K--T--P--N--N--P--S--C--N--A--D--L--I--N--R--V--L--L--D--A--G--F--T-
TCTTTTAAATTTCAACGAGTTTATTGATAGAAAAACTCCAAACAACCCATCATGTAACGCGGATTTGATTAATAGAGTCTTGCTTGATGCAGGCTTTACA
:::::::::.::.::.::::::::::::::::::::::::::::::::::::   :::.:.::::::::::::::::::::::: :::::.:::::::::
TCTTTTAAACTTTAATGAGTTTATTGATAGAAAAACTCCAAACAACCCATCA---AACACAGATTTGATTAATAGAGTCTTGCTGGATGCGGGCTTTACA
--L--L--N--F--N--E--F--I--D--R--K--T--P--N--N--P--S-----N--T--D--L--I--N--R--V--L--L--D--A--G--F--T-

----------------------------------------><----------------------------------------------------------
-N--E--L--V--Q--N--Y--W--S--K--Q--K--N--I--K--G--V--K--A--R--F--V--V--T--D--G--G--I--T--R--V--Y--P--
AATGAACTTGTCCAAAATTACTGGAGTAAGCAGAAAAATATCAAGGGAGTGAAAGCACGATTTGTTGTGACTGATGGTGGGATTACCAGAGTTTATCCCA
::::::::::::::::::::::::::::::::::::                                                                
AATGAACTTGTCCAAAATTACTGGAGTAAGCAGAAA----------------------------------------------------------------
-N--E--L--V--Q--N--Y--W--S--K--Q--K-----------------------------------------------------------------

---><-----------------------------------------------------------------------------------------------
K--E--A--G--E--N--W--Q--E--N--P--E--T--Y--E--D--S--F--Y--K--R--S--L--D--N--D--N--Y--V--F--T--A--P--Y
AAGAGGCTGGAGAAAATTGGCAAGAAAACCCAGAGACATATGAGGACAGCTTCTATAAAAGGAGCCTAGATAATGATAACTATGTTTTCACTGCTCCCTA
     :::::::::::::::::::::::::::::.::::::::::::::::::::::::::.::.::::::::.::::::::::::::::::::::::::
-----GCTGGAGAAAATTGGCAAGAAAACCCAGAAACATATGAGGACAGCTTCTATAAAAGAAGTCTAGATAACGATAACTATGTTTTCACTGCTCCCTA
------A--G--E--N--W--Q--E--N--P--E--T--Y--E--D--S--F--Y--K--R--S--L--D--N--D--N--Y--V--F--T--A--P--Y

-------><-------------------------------------------------------------------------------------><----
--F--N--K--S--G--P--G--A--Y--E--S--G--I--M--V--S--K--A--V--E--I--Y--I--Q--G--K--L--L--K--P--A--V--V-
CTTTAACAAAAGTGGACCTGGTGCCTATGAATCGGGCATTATGGTAAGCAAAGCTGTAGAAATATATATTCAAGGGAAACTTCTTAAACCTGCAGTTGTT
:::::::   ::::::::::::::.::::::::.:::::.::::::::::::::::::::::::::.::.:::::.::::::::::::::::::   :::
CTTTAAC---AGTGGACCTGGTGCTTATGAATCAGGCATCATGGTAAGCAAAGCTGTAGAAATATACATCCAAGGAAAACTTCTTAAACCTGCA---GTT
--F--N-----S--G--P--G--A--Y--E--S--G--I--M--V--S--K--A--V--E--I--Y--I--Q--G--K--L--L--K--P--A-----V-

--------------------------------------------------------------><------------------------------------
-G--I--K--I--D--V--N--S--W--I--E--N--F--T--K--T--S--I--R--D--P--C--A--G--P--V--C--D--C--K--R--N--S--
GGAATTAAAATTGATGTAAATTCCTGGATAGAGAATTTCACCAAAACCTCAATCAGAGATCCGTGTGCTGGTCCAGTTTGTGACTGCAAAAGAAACAGTG
::::::::::::::::::::::::::::::::::::::::::::::: ::::::::.::::::::::::::::::::::::::.::.:::::::::::: 
GGAATTAAAATTGATGTAAATTCCTGGATAGAGAATTTCACCAAAACATCAATCAGGGATCCGTGTGCTGGTCCAGTTTGTGATTGTAAAAGAAACAGT-
-G--I--K--I--D--V--N--S--W--I--E--N--F--T--K--T--S--I--R--D--P--C--A--G--P--V--C--D--C--K--R--N--S--

-><----------------------------------------------------------------------><-------------------------
D--V--M--D--C--V--I--L--D--D--G--G--F--L--L--M--A--N--H--D--D--Y--T--N--Q--I--G--R--F--F--G--E--I--D
ACGTAATGGATTGTGTGATTCTGGATGATGGTGGGTTTCTTCTGATGGCAAATCATGATGATTATACTAATCAGATTGGAAGATTTTTTGGAGAGATTGA
  ::::::::::::::::::::.::::::::::::::::::.::::::::::::::::::::::::::::.:::::::::::.:::::::::::::::::
--GTAATGGATTGTGTGATTCTAGATGATGGTGGGTTTCTTTTGATGGCAAATCATGATGATTATACTAACCAGATTGGAAGGTTTTTTGGAGAGATTGA
---V--M--D--C--V--I--L--D--D--G--G--F--L--L--M--A--N--H--D--D--Y--T--N--Q--I--G--R--F--F--G--E--I--D

----------------------------------------------------------------------------------------------------
--P--S--L--M--R--H--L--V--N--I--S--V--Y--A--F--N--K--S--Y--D--Y--Q--S--V--C--E--P--G--A--A--P--K--Q-
TCCCAGCTTGATGAGACACCTGGTTAATATATCAGTTTATGCTTTTAACAAATCTTATGATTATCAGTCAGTATGTGAGCCCGGTGCTGCACCAAAACAA
.:: ::.::::::::::::::::::::::::::::::::::::::::::::::::::.::::::::::::::.::::::::.::::::::::::::::::
CCCAAGTTTGATGAGACACCTGGTTAATATATCAGTTTATGCTTTTAACAAATCTTACGATTATCAGTCAGTGTGTGAGCCTGGTGCTGCACCAAAACAA
--P--S--L--M--R--H--L--V--N--I--S--V--Y--A--F--N--K--S--Y--D--Y--Q--S--V--C--E--P--G--A--A--P--K--Q-

--------------------------><---------------------------------------------------><-------------------
-G--A--G--H--R--S--A--Y--V--P--S--V--A--D--I--L--Q--I--G--W--W--A--T--A--A--A--W--S--I--L--Q--Q--F--
GGAGCAGGACATCGCTCAGCATATGTGCCATCAGTAGCAGACATATTACAAATTGGCTGGTGGGCCACTGCTGCTGCCTGGTCTATTCTACAGCAGTTTC
:::::::::::::::::::::::::::::::::.:::::::::: ::::: :::::::::::::::::::: :::      :::::::::::::::::::
GGAGCAGGACATCGCTCAGCATATGTGCCATCAATAGCAGACATCTTACACATTGGCTGGTGGGCCACTGCAGCT------TCTATTCTACAGCAGTTTC
-G--A--G--H--R--S--A--Y--V--P--S--I--A--D--I--L--H--I--G--W--W--A--T--A--A--------S--I--L--Q--Q--F--

-----------------------------------><---------------------------------------------------------------
L--L--S--L--T--F--P--R--L--L--E--A--V--E--M--E--D--D--D--F--T--A--S--L--S--K--Q--S--C--I--T--E--Q--T
TCTTGAGTTTGACCTTTCCACGACTCCTTGAGGCAGTTGAGATGGAGGATGATGACTTCACGGCCTCCCTGTCCAAGCAGAGCTGCATTACTGAACAAAC
:::::::::::::::::::::::::.:::::.:::   ::::::::.:::::::::::.:: :::::.::::: ::::::::.:::::::::::::::::
TCTTGAGTTTGACCTTTCCACGACTTCTTGAAGCA---GAGATGGAAGATGATGACTTTACCGCCTCTCTGTCAAAGCAGAGTTGCATTACTGAACAAAC
L--L--S--L--T--F--P--R--L--L--E--A-----E--M--E--D--D--D--F--T--A--S--L--S--K--Q--S--C--I--T--E--Q--T

-----------------------------------------------------------------><---------------------------------
--Q--Y--F--F--D--N--D--S--K--S--F--S--G--V--L--D--C--G--N--C--S--R--I--F--H--G--E--K--L--M--N--T--N-
CCAGTATTTCTTCGATAACGACAGTAAATCATTCAGTGGTGTATTAGACTGTGGAAACTGTTCCAGAATCTTTCATGGAGAAAAGCTTATGAACACCAAC
::::::::::::.:::::.::.::.::::: :::::::: :: ::.:::::::: :::::::::   ::::::::.:  :::::.:::::::::::::::
CCAGTATTTCTTTGATAATGATAGCAAATCCTTCAGTGGGGTCTTGGACTGTGGTAACTGTTCC---ATCTTTCACGTTGAAAAACTTATGAACACCAAC
--Q--Y--F--F--D--N--D--S--K--S--F--S--G--V--L--D--C--G--N--C--S-----I--F--H--V--E--K--L--M--N--T--N-

------------------------------------------------------------------------------><--------------------
-L--I--F--I--M-----V--E--S--K--G--T--C--P--C--D--T--R--L--L--I--Q--A--E--Q--T--S--D--G--P--N--P--C--
TTAATATTCATAATG---GTTGAGAGCAAAGGGACATGTCCATGTGACACACGACTGCTCATACAAGCGGAGCAGACTTCTGACGGTCCAAATCCTTGTG
:::::::::::::::   :::::::::::::::                                                                   
TTAATATTCATAATGG--GTTGAGAGCAAAGGG-------------------------------------------------------------------
-L--I--F--I--M--\--V--E--S--K--G--------------------------------------------------------------------

-------------------------------------------------------------><-------------------------------------
D--M--V--K--Q--P--R--Y--R--K--G--P--D--V--C--F--D--N--N--V--L--E--D--Y--T--D--C--G--G--V--S--G--L--N
ACATGGTTAAGCAACCCAGATACCGAAAAGGGCCTGATGTCTGCTTTGATAACAATGTCTTGGAGGATTATACTGACTGTGGTGGTGTTTCTGGATTAAA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

------------------------------------------------------------------------------>
--P--S--L--W--Y--I--I--G--I--Q--F--L--L--L--W--L--V--S--G--S--T--H--R--L--L--*-
TCCCTCCCTGTGGTATATCATTGGAATCCAGTTTCTACTACTTTGGCTGGTATCTGGCAGCACACACCGCCTGTTATGA
                                                                               
-------------------------------------------------------------------------------
-------------------------------------------------------------------------------

Pig Consensus Sequence

>BGISUST0000885954
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
------------------------------------------------------------------------------------------------CCTG
AAAAAAATGACAGTGAGCCAGGCAGCCAGAGGATAAAACGGGTTTTTATTGATGATGCTAATTTTGGGCGACAGATATCTTATCAGCATGCAGCAGTCCA
TATTCCCACCGACATCTATGAGGGC---ACAATTGTGTTAAATGAACTGAACTGGACAAGTGCCTTAGATGAAGTTTTCAAGAAAAATCGAGAGGAAGAT
CCCTCATTATTGTGGCAGGTGTTTGGCAGTGCCACAGGCCTGGCCCGGTATTATCCA---TCTCCATGGGTTGATAACAGTAGAACTCCAAACAAGATTG
ACCTTTATGATGTACGAAGGAGACCA---TACATCCAAGGAGCTGCATCTCCTAAAGATATGCTTATTCTGGTC------AGTGGAAGTGTTAGTGGTTT
GACGCTTAAACTGATCCGAACATCTGTCTCTGAAATGTTGGAAACCCTCTCAGATGACGATTTTGTGAATGTAGCTTCATTTAACAGCAATGCCCAGGAT
GTAAGCTGTTTTCAACACCTTGTCCAAGCAAATGTAAGAAATAAGAAAGTGCTGAAAGATGCAGTTAATAATATCACAGCAAAAGGAATCACAGATTACA
AGAAGGGCTTTAGTTTTGCTTTTGAACAACTGCTTAATTATAACGTTTCTAGAGCCAACTGCAATAAGATTATCATGTTGTTCACCGATGGAGGAGAAGA
GAGAGCTCAGGAGATATTTGCCAAATACAACAAAGACAAAAAAGTACGTGTATTCACATTTTCAGTTGGTCAACATAATTATGACAGAGGACCTATTCAG
TGGATGGCCTGTGAAAATAAA---------------------------------------------------GAATATTTGGATGTTCTGGGAAGACCAA
TGGTTTTAGCAGGAGACAAAGCTAAGCAAGTCCAGTGGACAAACGTGTACCTGGATGCACTGGAACTGGGACTTGTCATTACTGGAACTCTTCCGGTCTT
CAACATAACCGGCCAAAATGAAAATAAGACGAACTTAAAGAACCAGCTGATTCTTGGTGTGATGGGAGTTGATGTATCTTTGGAAGATATTAAAAGACTG
ACACCACGTTTTACACTGTGCCCCAATGGCTATTACTTTGCAATTGATCCTAATGGCTATGTTTTATTACATCCAAATCTTCAGCCAAAG----------
----------------------------------------------------------------------------------------------------
----------------------------------AGATATATTGACAAAGGAAACAGGACATATACATGGACTCCTGTCAATGGCACAGATTAC---TTG
GCCTTGGTATTACCAACCTACAGTTTTTACTATATAAAAGCCAAAATAGAAGAGACAATAACTCAGGCCAGA----------------------------
--------------------------------------------------------GACTACTGCAATGACCTTAAAATATCAGATAATAATACCGAATT
TCTTTTAAACTTTAATGAGTTTATTGATAGAAAAACTCCAAACAACCCATCA---AACACAGATTTGATTAATAGAGTCTTGCTGGATGCGGGCTTTACA
AATGAACTTGTCCAAAATTACTGGAGTAAGCAGAAA----------------------------------------------------------------
-----GCTGGAGAAAATTGGCAAGAAAACCCAGAAACATATGAGGACAGCTTCTATAAAAGAAGTCTAGATAACGATAACTATGTTTTCACTGCTCCCTA
CTTTAAC---AGTGGACCTGGTGCTTATGAATCAGGCATCATGGTAAGCAAAGCTGTAGAAATATACATCCAAGGAAAACTTCTTAAACCTGCA---GTT
GGAATTAAAATTGATGTAAATTCCTGGATAGAGAATTTCACCAAAACATCAATCAGGGATCCGTGTGCTGGTCCAGTTTGTGATTGTAAAAGAAACAGT-
--GTAATGGATTGTGTGATTCTAGATGATGGTGGGTTTCTTTTGATGGCAAATCATGATGATTATACTAACCAGATTGGAAGGTTTTTTGGAGAGATTGA
CCCAAGTTTGATGAGACACCTGGTTAATATATCAGTTTATGCTTTTAACAAATCTTACGATTATCAGTCAGTGTGTGAGCCTGGTGCTGCACCAAAACAA
GGAGCAGGACATCGCTCAGCATATGTGCCATCAATAGCAGACATCTTACACATTGGCTGGTGGGCCACTGCAGCT------TCTATTCTACAGCAGTTTC
TCTTGAGTTTGACCTTTCCACGACTTCTTGAAGCA---GAGATGGAAGATGATGACTTTACCGCCTCTCTGTCAAAGCAGAGTTGCATTACTGAACAAAC
CCAGTATTTCTTTGATAATGATAGCAAATCCTTCAGTGGGGTCTTGGACTGTGGTAACTGTTCC---ATCTTTCACGTTGAAAAACTTATGAACACCAAC
TTAATATTCATAATggTTGAGAGCAAAGGG----------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------


>BGISUSP0000885954
----------------------------------------------------------------------------------------------------
--------------------------------PEKNDSEPGSQRIKRVFIDDANFGRQISYQHAAVHIPTDIYEG-TIVLNELNWTSALDEVFKKNREED
PSLLWQVFGSATGLARYYP-SPWVDNSRTPNKIDLYDVRRRP-YIQGAASPKDMLILV--SGSVSGLTLKLIRTSVSEMLETLSDDDFVNVASFNSNAQD
VSCFQHLVQANVRNKKVLKDAVNNITAKGITDYKKGFSFAFEQLLNYNVSRANCNKIIMLFTDGGEERAQEIFAKYNKDKKVRVFTFSVGQHNYDRGPIQ
WMACENK-----------------EYLDVLGRPMVLAGDKAKQVQWTNVYLDALELGLVITGTLPVFNITGQNENKTNLKNQLILGVMGVDVSLEDIKRL
TPRFTLCPNGYYFAIDPNGYVLLHPNLQPK------------------------------------------------RYIDKGNRTYTWTPVNGTDY-L
ALVLPTYSFYYIKAKIEETITQAR----------------------------DYCNDLKISDNNTEFLLNFNEFIDRKTPNNPS-NTDLINRVLLDAGFT
NELVQNYWSKQK-----------------------AGENWQENPETYEDSFYKRSLDNDNYVFTAPYFN-SGPGAYESGIMVSKAVEIYIQGKLLKPA-V
GIKIDVNSWIENFTKTSIRDPCAGPVCDCKRNS-VMDCVILDDGGFLLMANHDDYTNQIGRFFGEIDPSLMRHLVNISVYAFNKSYDYQSVCEPGAAPKQ
GAGHRSAYVPSIADILHIGWWATAA--SILQQFLLSLTFPRLLEA-EMEDDDFTASLSKQSCITEQTQYFFDNDSKSFSGVLDCGNCS-IFHVEKLMNTN
LIFIMVESKG----------------------------------------------------------------------------------