Sequences
EST Library Info
Clusters
Oligos
SNPs

Gene ID ENSG00000146094 (click for geneview)
Transcript ID ENST00000357198(link to ensembl)
Symbol DOK3
Localtion Chromosome:5:176863358:176869459:-1 band: 5q35.3
Description Docking protein 3 (Downstream of tyrosine kinase 3). [Source:Uniprot/SWISSPROT;Acc:Q7L591]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<-------------------------------------------------><------------------------------------------------
-M--T--R--G--A--R--L--R--S--D--A--R--A--Q--L--N--Q--L--S--L--D--G--G--T--G--S--G--Q--K--G--K--C--E--
ATGACTCGGGGAGCCAGACTGCGATCAGACGCGCGTGCCCAGCTGAACCAGCTGTCTCTAGACGGAGGGACGGGAAGTGGCCAGAAGGGGAAGTGTGAGG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
E--F--P--S--S--L--S--S--V--S--P--G--L--E--A--A--A--L--L--L--A--V--T--M--D--P--L--E--T--P--I--K--D--G
AGTTCCCGTCCAGCCTGTCATCAGTCTCCCCAGGTCTTGAAGCGGCGGCCCTGCTCCTGGCCGTGACCATGGACCCTCTGGAGACCCCTATCAAGGATGG
                                                                             ::.::::::::.:::::::::::
-----------------------------------------------------------------------------CTAGAGACCCCCATCAAGGATGG
------------------------------------------------------------------------------L--E--T--P--I--K--D--G

---------------------------------><-----------------------------------------------------------------
--I--L--Y--Q--Q--H--V--K--F--G--K--K--C--W--R--K--V--W--A--L--L--Y--A--G--G--P--S--G--V--A--R--L--E-
CATCCTCTACCAGCAGCATGTCAAGTTTGGCAAGAAGTGCTGGCGGAAGGTGTGGGCTCTGCTGTATGCAGGAGGCCCATCAGGCGTGGCACGGCTGGAG
:::::::::::::::::: :::::.::::::::::::: .:::::::::.:::::: ::::::::::::.::::::::::::::::::::::::::::::
CATCCTCTACCAGCAGCAAGTCAAATTTGGCAAGAAGTCTTGGCGGAAGATGTGGGGTCTGCTGTATGCGGGAGGCCCATCAGGCGTGGCACGGCTGGAG
--I--L--Y--Q--Q--Q--V--K--F--G--K--K--S--W--R--K--M--W--G--L--L--Y--A--G--G--P--S--G--V--A--R--L--E-

----------------------------------------------------------------------------------------------------
-S--W--E--V--R--D--G--G--L--G--A--A--G--D--R--S--A--G--P--G--R--R--G--E--R--R--V--I--R--L--A--D--C--
AGCTGGGAGGTCCGGGATGGTGGCCTGGGAGCAGCGGGTGACAGGTCGGCAGGGCCTGGCCGGCGAGGGGAGCGACGGGTCATCCGCCTGGCTGACTGTG
::::::::: :.:::::::::::::::::. ::.:.::::::::::: : .:::::..:::::::.:::::: :.:::::::::::::::::.:::::::
AGCTGGGAGTTTCGGGATGGTGGCCTGGGGCCAACAGGTGACAGGTCTGGGGGGCCCAGCCGGCGGGGGGAGAGGCGGGTCATCCGCCTGGCCGACTGTG
-S--W--E--F--R--D--G--G--L--G--P--T--G--D--R--S--G--G--P--S--R--R--G--E--R--R--V--I--R--L--A--D--C--

----------------------------------------------------------------------------------------------------
V--S--V--L--P--A--D--G--E--S--C--P--R--D--T--G--A--F--L--L--T--T--T--E--R--S--H--L--L--A--A--Q--H--R
TGTCCGTGCTGCCGGCTGACGGCGAGAGCTGCCCCCGGGACACCGGTGCCTTCCTGCTCACCACCACCGAGCGAAGCCATCTACTGGCTGCTCAGCACCG
:::::::::::::::::::.::.::::::::.::::::::::::.:.:::::::::::::::::::: :::::::::::.::.:::::::: ::::::::
TGTCCGTGCTGCCGGCTGATGGTGAGAGCTGTCCCCGGGACACCAGCGCCTTCCTGCTCACCACCACGGAGCGAAGCCACCTGCTGGCTGCACAGCACCG
V--S--V--L--P--A--D--G--E--S--C--P--R--D--T--S--A--F--L--L--T--T--T--E--R--S--H--L--L--A--A--Q--H--R

---------------------------------------><-----------------------------------------------------------
--Q--A--W--M--G--P--I--C--Q--L--A--F--P--G--T--G--E--A--S--S--G--S--T--D--A--Q--S--P--K--R--G--L--V-
CCAGGCCTGGATGGGCCCCATCTGCCAGCTGGCCTTCCCGGGGACAGGGGAGGCCTCCTCAGGATCCACAGATGCCCAGTCTCCCAAGAGGGGCCTGGTC
:::::  :::::::.::::::::::::::::::::::::::: :::::::::. :::::::::::: . .:: ::  :: ::::::::::::.:: :::.
CCAGGAGTGGATGGACCCCATCTGCCAGCTGGCCTTCCCGGGCACAGGGGAGAGCTCCTCAGGATCAGGGGAGGCGGAGGCTCCCAAGAGGGACCGGGTT
--Q--E--W--M--D--P--I--C--Q--L--A--F--P--G--T--G--E--S--S--S--G--S--G--E--A--E--A--P--K--R--D--R--V-

---------------------------------------><-----------------------------------------------------------
-P--M--E--E--N--S--I--Y--S--S--W--Q--E--V--G--E--F--P--V--V--V--Q--R--T--E--A--A--T--R--C--Q--L--K--
CCCATGGAGGAAAACTCCATCTACTCCTCCTGGCAGGAAGTGGGCGAGTTTCCCGTGGTGGTGCAGAGGACTGAGGCCGCCACCCGCTGCCAGCTGAAGG
:::::::::::.:::::::::::::::::::::::::::   : ::::::::: :::::::::::::::::::::::::: .::::::::::::::::::
CCCATGGAGGAGAACTCCATCTACTCCTCCTGGCAGGAA---GTCGAGTTTCCGGTGGTGGTGCAGAGGACTGAGGCCGCGGCCCGCTGCCAGCTGAAGG
-P--M--E--E--N--S--I--Y--S--S--W--Q--E-----V--E--F--P--V--V--V--Q--R--T--E--A--A--A--R--C--Q--L--K--

----------------------------------------------------------------------------------------------------
G--P--A--L--L--V--L--G--P--D--A--I--Q--L--R--E--A--K--G--T--Q--A--L--Y--S--W--P--Y--H--F--L--R--K--F
GGCCGGCCCTGCTGGTGCTGGGCCCAGACGCCATCCAGCTGAGGGAGGCCAAGGGCACCCAGGCCCTCTACAGCTGGCCCTACCACTTCCTGCGCAAGTT
::::   ::: ::: ::::::::: .::: :::::::::::::.::: ::   .:: ::::: : ::::::: :::::::::::.:::::::::::::::
GGCCCTACCTCCTGCTGCTGGGCCAGGACTCCATCCAGCTGAGAGAGCCCCCCAGCCCCCAGCCGCTCTACACCTGGCCCTACCGCTTCCTGCGCAAGTT
G--P--Y--L--L--L--L--G--Q--D--S--I--Q--L--R--E--P--P--S--P--Q--P--L--Y--T--W--P--Y--R--F--L--R--K--F

------------><--------------------------------------------------------------------------------------
--G--S--D--K--G--V--F--S--F--E--A--G--R--R--C--H--S--G--E--G--L--F--A--F--S--T--P--C--A--P--D--L--C-
CGGCTCCGACAAGGGCGTGTTCTCCTTTGAGGCCGGCCGTCGCTGCCACTCGGGTGAGGGCCTCTTTGCCTTCAGCACCCCCTGTGCCCCTGACCTGTGC
:::::::::: ::::.::::::::::::::.::::::::.:::::: :::::::.:::::::::::.::.::::::: ::::.:.:::: .:::::::::
CGGCTCCGACCAGGGTGTGTTCTCCTTTGAAGCCGGCCGCCGCTGCGACTCGGGCGAGGGCCTCTTCGCTTTCAGCAGCCCCCGCGCCCGCGACCTGTGC
--G--S--D--Q--G--V--F--S--F--E--A--G--R--R--C--D--S--G--E--G--L--F--A--F--S--S--P--R--A--R--D--L--C-

----------------------------------------------------------------------------------------------------
-R--A--V--A--G--A--I--A--R--Q--R--E--R--L--P--E--L--T--R--P--Q--P--C--P--L--P--R--A--T--S--L--P--S--
AGGGCTGTGGCCGGGGCCATCGCCCGCCAGCGGGAGCGGCTGCCAGAGCTGACCAGGCCCCAGCCCTGCCCCCTGCCACGGGCCACCTCTCTGCCCTCCC
.:.::.:::::.:  :::::::::::::::::::::::.:: ::.::::.:.: .::::.:. :::::::::                            
GGAGCCGTGGCTGCCGCCATCGCCCGCCAGCGGGAGCGACTCCCGGAGCCGGCGGGGCCTCGTCCCTGCCCC----------------------------
-G--A--V--A--A--A--I--A--R--Q--R--E--R--L--P--E--P--A--G--P--R--P--C--P-----------------------------

----------------------------------------------------------------------------------------------------
L--D--T--P--G--E--L--R--E--M--P--P--G--P--E--P--P--T--S--R--K--M--H--L--A--E--P--G--P--Q--S--L--P--L
TGGACACCCCCGGAGAGCTTCGGGAGATGCCACCAGGACCTGAGCCACCCACGTCCAGGAAAATGCACCTGGCCGAGCCCGGACCCCAGAGCCTGCCGCT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--L--L--G--P--E--P--N--D--L--A--S--G--L--Y--A--S--V--C--K--R--A--S--G--P--P--G--N--E--H--L--Y--E--N-
ACTGCTAGGCCCGGAGCCCAACGATCTGGCGTCCGGGCTCTACGCTTCAGTGTGCAAGCGTGCCAGTGGGCCCCCAGGCAATGAGCACCTCTATGAGAAC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-L--C--V--L--E--A--S--P--T--L--H--G--G--E--P--E--P--H--E--G--P--G--S--R--S--P--T--T--S--P--I--Y--H--
CTGTGTGTGCTGGAGGCCAGCCCCACGCTGCACGGTGGGGAACCTGAGCCGCACGAGGGCCCCGGCAGCCGCAGCCCCACAACCAGTCCCATCTACCACA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
N--G--Q--D--L--S--W--P--G--P--A--N--D--S--T--L--E--A--Q--Y--R--R--L--L--E--L--D--Q--V--E--G--T--G--R
ACGGCCAGGACTTGAGCTGGCCCGGCCCGGCCAACGACAGTACCCTGGAGGCCCAGTACCGGCGGCTGCTGGAGCTGGATCAGGTGGAGGGCACAGGCCG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

------------------------------------------------------------------------------------------>
--P--D--P--Q--A--G--F--K--A--K--L--V--T--L--L--S--R--E--R--R--K--G--P--A--P--C--D--R--P--*-
CCCTGACCCTCAGGCAGGTTTCAAGGCCAAGCTGGTGACCCTGCTGAGTCGTGAGCGGAGGAAGGGCCCAGCCCCTTGTGACCGGCCCTGA
                                                                                           
-------------------------------------------------------------------------------------------
-------------------------------------------------------------------------------------------

Pig Consensus Sequence

>BGISUST0000882097
----------------------------------------------------------------------------------------------------
-----------------------------------------------------------------------------CTAGAGACCCCCATCAAGGATGG
CATCCTCTACCAGCAGCAAGTCAAATTTGGCAAGAAGTCTTGGCGGAAGATGTGGGGTCTGCTGTATGCGGGAGGCCCATCAGGCGTGGCACGGCTGGAG
AGCTGGGAGTTTCGGGATGGTGGCCTGGGGCCAACAGGTGACAGGTCTGGGGGGCCCAGCCGGCGGGGGGAGAGGCGGGTCATCCGCCTGGCCGACTGTG
TGTCCGTGCTGCCGGCTGATGGTGAGAGCTGTCCCCGGGACACCAGCGCCTTCCTGCTCACCACCACGGAGCGAAGCCACCTGCTGGCTGCACAGCACCG
CCAGGAGTGGATGGACCCCATCTGCCAGCTGGCCTTCCCGGGCACAGGGGAGAGCTCCTCAGGATCAGGGGAGGCGGAGGCTCCCAAGAGGGACCGGGTT
CCCATGGAGGAGAACTCCATCTACTCCTCCTGGCAGGAA---GTCGAGTTTCCGGTGGTGGTGCAGAGGACTGAGGCCGCGGCCCGCTGCCAGCTGAAGG
GGCCCTACCTCCTGCTGCTGGGCCAGGACTCCATCCAGCTGAGAGAGCCCCCCAGCCCCCAGCCGCTCTACACCTGGCCCTACCGCTTCCTGCGCAAGTT
CGGCTCCGACCAGGGTGTGTTCTCCTTTGAAGCCGGCCGCCGCTGCGACTCGGGCGAGGGCCTCTTCGCTTTCAGCAGCCCCCGCGCCCGCGACCTGTGC
GGAGCCGTGGCTGCCGCCATCGCCCGCCAGCGGGAGCGACTCCCGGAGCCGGCGGGGCCTCGTCCCTGCCCC----------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
-------------------------------------------------------------------------------------------


>BGISUSP0000882097
-----------------------------------------------------------LETPIKDGILYQQQVKFGKKSWRKMWGLLYAGGPSGVARLE
SWEFRDGGLGPTGDRSGGPSRRGERRVIRLADCVSVLPADGESCPRDTSAFLLTTTERSHLLAAQHRQEWMDPICQLAFPGTGESSSGSGEAEAPKRDRV
PMEENSIYSSWQE-VEFPVVVQRTEAAARCQLKGPYLLLLGQDSIQLREPPSPQPLYTWPYRFLRKFGSDQGVFSFEAGRRCDSGEGLFAFSSPRARDLC
GAVAAAIARQRERLPEPAGPRPCP----------------------------------------------------------------------------
-------------------------------------------------------------------------------------------------