Sequences
EST Library Info
Clusters
Oligos
SNPs

Gene ID ENSG00000197057 (click for geneview)
Transcript ID ENST00000357504(link to ensembl)
Symbol Q6ZMT9_HUMAN
Localtion Chromosome:4:36105810:36167982:1 band: 4p14
Description PREDICTED: hypothetical protein XP_379262
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------><----------------------------------------------------------------------------------
-M--C--L--E--K--R--Y--L--D--V--L--S--D--V--T--G--P--Q--V--S--C--Y--I--T--A--P--S--Y--V--L--Q--Q--L--
ATGTGTCTCGAGAAAAGGTATCTTGATGTGCTGAGTGATGTTACTGGCCCCCAAGTGTCTTGTTATATTACAGCACCATCATATGTTCTACAACAACTAG
                  ::::::::::::::::.::::. ::::  ::::::::::::::::::.:::::::::::::: : :::::::::.:  ::::
------------------TATCTTGATGTGCTGAATGATAATACTCTCCCCCAAGTGTCTTGTTACATTACAGCACCATCCTCTGTTCTACAGCTTCTAG
-------------------Y--L--D--V--L--N--D--N--T--L--P--Q--V--S--C--Y--I--T--A--P--S--S--V--L--Q--L--L--

----------------------------------------------------------------------------------------------------
E--C--R--I--I--N--H--M--S--S--L--I--V--G--D--N--E--E--L--V--S--N--V--I--T--I--E--C--S--D--K--E--K--R
AATGCCGGATAATAAATCACATGAGTTCTTTAATAGTGGGTGATAATGAAGAGTTAGTTAGCAACGTCATAACTATTGAATGCTCAGATAAGGAAAAGAG
::::::::::::: ::: ..::::::::::::.:::::.::::.:::::.:::::.::.:::::.::::: :::.::::.:::::::: : :::::::::
AATGCCGGATAATTAATAGTATGAGTTCTTTAGTAGTGAGTGACAATGAGGAGTTGGTCAGCAATGTCATCACTGTTGAGTGCTCAGAAATGGAAAAGAG
E--C--R--I--I--N--S--M--S--S--L--V--V--S--D--N--E--E--L--V--S--N--V--I--T--V--E--C--S--E--M--E--K--R

----------------------------------------------------------------------------------------------------
--V--P--F--P--I--G--I--A--I--P--F--T--A--R--Y--R--G--N--Y--R--D--I--M--V--K--V--C--D--I--N--L--Q--S-
AGTTCCATTTCCAATAGGCATTGCAATTCCATTTACTGCACGTTACAGAGGAAATTACAGAGATATCATGGTGAAAGTGTGTGACATAAACCTTCAATCA
:.:::::::::::::: ::::::::::::::::::::::::::::::::::::::::::::::.:::::::::::::::: :::.::::::.::::.:::
AATTCCATTTCCAATATGCATTGCAATTCCATTTACTGCACGTTACAGAGGAAATTACAGAGACATCATGGTGAAAGTGTCTGATATAAACTTTCAGTCA
--I--P--F--P--I--C--I--A--I--P--F--T--A--R--Y--R--G--N--Y--R--D--I--M--V--K--V--S--D--I--N--F--Q--S-

-----------------------------------------------><---------------------------------------------------
-S--Y--L--N--P--N--S--L--E--G--M--K--G--G--Y--K--G--T--C--A--S--V--K--V--Y--K--L--G--I--F--S--V--V--
AGTTACCTAAACCCAAATTCACTAGAAGGAATGAAGGGAGGTTATAAGGGGACCTGTGCTTCAGTAAAAGTTTACAAATTGGGTATCTTTTCTGTTGTGT
::::::.:.: .:::::::::::.::::::::::..:::.::::.:::                                                    
AGTTACTTGACTCCAAATTCACTGGAAGGAATGAGAGGAAGTTACAAG----------------------------------------------------
-S--Y--L--T--P--N--S--L--E--G--M--R--G--S--Y--K-----------------------------------------------------

----------------------------------------------------------------------------------------------------
S--C--L--K--K--E--S--F--T--V--T--K--K--G--L--A--L--K--S--S--M--D--S--R--I--S--L--N--Y--P--P--G--V--F
CTTGTTTAAAGAAAGAGTCGTTCACAGTAACAAAGAAAGGCCTCGCTCTTAAGTCAAGCATGGATTCCCGAATATCCTTAAATTACCCTCCAGGAGTTTT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

---------------------------><-----------------------------------------------------------------------
--T--S--P--V--L--V--Q--L--K--I--Q--P--V--D--P--A--L--V--A--H--L--K--A--Q--Q--D--T--F--Y--S--V--Q--S-
TACCTCTCCAGTGCTGGTGCAGTTAAAGATCCAACCAGTTGACCCAGCTCTGGTGGCACATTTAAAAGCACAGCAAGATACTTTCTACTCAGTCCAATCC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-T--S--P--L--I--H--I--Q--H--P--S--T--Y--P--F--Q--K--P--V--T--L--F--L--P--C--S--P--Y--L--D--K--N--N--
ACAAGCCCTCTGATTCACATTCAGCACCCATCAACTTATCCTTTTCAGAAGCCAGTCACTTTGTTTTTACCTTGTTCTCCATACCTTGATAAAAACAACC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

------------------------------------------------------------------------><--------------------------
L--G--S--E--I--D--H--K--R--R--A--S--A--T--I--N--R--I--T--P--S--Y--F--N--R--T--K--I--A--S--I--R--K--P
TTGGTTCTGAGATAGATCATAAAAGAAGAGCAAGTGCCACAATAAATAGGATTACACCTTCGTATTTCAACCGGACAAAAATTGCCTCCATAAGAAAACC
                                                                          ::::::   .:.::::::::::::::
--------------------------------------------------------------------------ACAAAACGAACTTCCATAAGAAAACC
---------------------------------------------------------------------------T--K--R--T--S--I--R--K--P

----------------------------------------------------------------------------------------------------
--R--K--N--A--S--E--C--L--K--L--L--G--F--R--S--Q--D--S--G--W--C--G--L--D--D--V--V-----K--T--I--Q--S-
TAGGAAAAATGCCAGTGAATGTTTGAAATTACTGGGATTCAGAAGCCAAGACAGTGGTTGGTGTGGGCTTGATGATGTTGTG---AAAACCATACAGAGC
:   ..:::..:: :::::: ::::::::::.:::::::::::::::.:::::::::::::: :: ::::::::.:::::::   :.:::::.::::::.
T---GGAAACACCTGTGAATCTTTGAAATTATTGGGATTCAGAAGCCGAGACAGTGGTTGGTTTGTGCTTGATGGTGTTGTGGTGAGAACCACACAGAGT
-----G--N--T--C--E--S--L--K--L--L--G--F--R--S--R--D--S--G--W--F--V--L--D--G--V--V--V--R--T--T--Q--S-

-------------------------------------><-------------------------------------------------------------
-G--L--V--S--V--E--L--Y--E--H--L--E--R--F--I--V--L--H--L--S--S--T--M--D--N--S--H--L--V--T--F--V--K--
GGCTTGGTATCAGTTGAATTGTATGAACATTTGGAGAGGTTTATTGTACTTCACCTCTCTTCCACCATGGACAATAGTCATTTGGTTACTTTTGTGAAAT
::::::.::::: :::::::::.:::::::::.:::   ::::::::.::::..:: :::::::..::::: :::::.:::::: :: ::::::::::.:
GGCTTGATATCATTTGAATTGTGTGAACATTTAGAG---TTTATTGTGCTTCGTCTGTCTTCCATTATGGAAAATAGCCATTTGCTTTCTTTTGTGAAGT
-G--L--I--S--F--E--L--C--E--H--L--E-----F--I--V--L--R--L--S--S--I--M--E--N--S--H--L--L--S--F--V--K--

----------------------------------------------------------------------------------------------------
S--L--E--E--A--M--L--S--T--T--A--C--I--V--L--S--H--Q--K--D--N--P--H--R--I--A--V--L--V--V--P--S--K--D
CTTTAGAGGAAGCCATGCTCAGCACCACTGCCTGCATAGTACTGTCTCACCAGAAGGACAATCCACATAGAATAGCTGTTTTAGTGGTGCCTTCCAAAGA
::::.::::::::::::.::::::::::::::::::: ::::: : .::::::::.:::::.:::::::::.: :.:.::::.:::::::::::.:::::
CTTTGGAGGAAGCCATGTTCAGCACCACTGCCTGCATTGTACTTTACCACCAGAAAGACAACCCACATAGAGTTGTTATTTTGGTGGTGCCTTCTAAAGA
S--L--E--E--A--M--F--S--T--T--A--C--I--V--L--Y--H--Q--K--D--N--P--H--R--V--V--I--L--V--V--P--S--K--D

----------------------------------------------------------------------------------------------------
--L--S--Q--V--L--K--D--L--H--L--E--G--F--G--G--P--P--E--P--S--R--H--F--Q--V--R--E--G--E--Q--L--L--L-
TTTAAGCCAGGTGCTTAAGGACCTGCACTTGGAAGGGTTTGGAGGACCTCCAGAGCCATCTCGTCATTTCCAAGTTCGAGAAGGAGAACAACTTCTTTTA
:::::.::::: :::.:.: ::.:::.:::::.:::..:..: :: :::::::::::::::::.:::::::::::  .::::::::::::::::::::::
TTTAAACCAGGAGCTCAGGCACTTGCGCTTGGGAGGACTCAGTGGTCCTCCAGAGCCATCTCGCCATTTCCAAGTGAAAGAAGGAGAACAACTTCTTTTA
--L--N--Q--E--L--R--H--L--R--L--G--G--L--S--G--P--P--E--P--S--R--H--F--Q--V--K--E--G--E--Q--L--L--L-

---------------------------><-----------------------------------------------------------------------
-R--F--T--G--N--I--F--A--S--S--N--G--K--D--Y--G--K--D--Y--T--L--I--F--H--L--Q--R--K--P--R--L--E--L--
AGATTTACTGGAAACATATTTGCTTCAAGCAACGGGAAGGATTATGGAAAAGACTACACACTTATTTTTCACTTGCAAAGAAAACCTAGGCTGGAACTCC
::.::::::::::::::::::::::::   ::.::::::::::::::::::::::::: .:::::::::::.::.:::::.::::::::..:::::::::
AGGTTTACTGGAAACATATTTGCTTCA---AATGGGAAGGATTATGGAAAAGACTACAAGCTTATTTTTCATTTACAAAGGAAACCTAGATTGGAACTCC
-R--F--T--G--N--I--F--A--S-----N--G--K--D--Y--G--K--D--Y--K--L--I--F--H--L--Q--R--K--P--R--L--E--L--

----------------------------------------------------------------------------------------------------
Q--I--K--E--V--D--E--F--G--N--Y--S--C--P--H--Y--K--G--T--I--V--V--Y--K--V--P--K--G--K--I--V--P--N--L
AAATCAAAGAAGTGGACGAATTTGGAAACTATAGTTGCCCTCATTACAAAGGCACCATTGTCGTTTATAAAGTACCTAAAGGAAAGATAGTCCCCAACTT
::::::::::.:::::.:::::::::::.::.::.::::::::::::::.::.::::::.: :::::::::::::::::::.:::::::::.: :::::.
AAATCAAAGAGGTGGATGAATTTGGAAATTACAGCTGCCCTCATTACAAGGGTACCATTATAGTTTATAAAGTACCTAAAGAAAAGATAGTTCACAACTC
Q--I--K--E--V--D--E--F--G--N--Y--S--C--P--H--Y--K--G--T--I--I--V--Y--K--V--P--K--E--K--I--V--H--N--S

------------------------------------------------------------------------><--------------------------
--N--Q--S--L--V--I--N--E--N--H--S--Q--L--P--I--C--K--L--P--L--K--L--P--K--H--K--K--L--I--N--R--P--Q-
GAATCAATCTCTCGTAATTAATGAAAACCATTCTCAGTTGCCAATTTGCAAATTACCATTGAAATTGCCAAAGCATAAGAAATTAATCAACCGTCCACAG
:.::::.:::::..:: ::::::::::: ::: :::::::::::::::::::::::::.:::.::::::::::                           
GGATCAGTCTCTTATACTTAATGAAAACAATTATCAGTTGCCAATTTGCAAATTACCACTGAGATTGCCAAAG---------------------------
--D--Q--S--L--I--L--N--E--N--N--Y--Q--L--P--I--C--K--L--P--L--R--L--P--K----------------------------

------------------------------><--------------------------------------------------------------------
-S--T--K--R--V--S--K--D--P--V--E--A--L--W--D--N--L--L--H--W--L--A--E--E--L--S--E--E--N--A--E--S--L--
AGTACCAAAAGAGTTTCTAAGGATCCTGTAGAAGCCCTTTGGGATAACTTGCTCCATTGGCTGGCTGAGGAGCTCTCAGAAGAAAATGCTGAGTCTCTTT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
S--S--T--L--P--L--R--R--S--T--I--Q--L--I--K--L--K--N--P--D--D--L--T--E--Q--I--H--E--F--L--C--F--W--K
CCTCAACTCTCCCTCTGCGCCGTAGCACCATTCAGCTCATCAAACTCAAGAACCCTGATGATCTCACAGAACAGATCCACGAGTTTCTTTGCTTCTGGAA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--K--S--L--P--T--F--T--D--K--L--R--L--L--A--R--H--L--R--K--I--G--R--S--D--L--A--E--E--L--K--F--K--W-
AAAATCGCTTCCAACTTTCACCGACAAACTTCGCCTCCTGGCTCGACATCTCCGCAAGATTGGCAGGAGTGATCTTGCAGAAGAGCTCAAATTCAAGTGG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------->
-E--N--K--V--F--T--E--P-
GAAAATAAAGTGTTCACTGAACCA
                        
------------------------
------------------------

Pig Consensus Sequence

>BGISUST0000894827
------------------TATCTTGATGTGCTGAATGATAATACTCTCCCCCAAGTGTCTTGTTACATTACAGCACCATCCTCTGTTCTACAGCTTCTAG
AATGCCGGATAATTAATAGTATGAGTTCTTTAGTAGTGAGTGACAATGAGGAGTTGGTCAGCAATGTCATCACTGTTGAGTGCTCAGAAATGGAAAAGAG
AATTCCATTTCCAATATGCATTGCAATTCCATTTACTGCACGTTACAGAGGAAATTACAGAGACATCATGGTGAAAGTGTCTGATATAAACTTTCAGTCA
AGTTACTTGACTCCAAATTCACTGGAAGGAATGAGAGGAAGTTACAAG----------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
--------------------------------------------------------------------------ACAAAACGAACTTCCATAAGAAAACC
TGGAAACACCTGTGAATCTTTGAAATTATTGGGATTCAGAAGCCGAGACAGTGGTTGGTTTGTGCTTGATGGTGTTGTGGTGAGAACCACACAGAGTGGC
TTGATATCATTTGAATTGTGTGAACATTTA---TTTATTGTGCTTCGTCTGTCTTCCATTATGGAAAATAGCCATTTGCTTTCTTTTGTGAAGTCTTTGG
AGGAAGCCATGTTCAGCACCACTGCCTGCATTGTACTTTACCACCAGAAAGACAACCCACATAGAGTTGTTATTTTGGTGGTGCCTTCTAAAGATTTAAA
CCAGGAGCTCAGGCACTTGCGCTTGGGAGGACTCAGTGGTCCTCCAGAGCCATCTCGCCATTTCCAAGTGAAAGAAGGAGAACAACTTCTTTTAAGGTTT
ACTGGAAACATATTTGCTTCA---AATGGGAAGGATTATGGAAAAGACTACAAGCTTATTTTTCATTTACAAAGGAAACCTAGATTGGAACTCCAAATCA
AAGAGGTGGATGAATTTGGAAATTACAGCTGCCCTCATTACAAGGGTACCATTATAGTTTATAAAGTACCTAAAGAAAAGATAGTTCACAACTCGGATCA
GTCTCTTATACTTAATGAAAACAATTATCAGTTGCCAATTTGCAAATTACCACTGAGATTGCCAAAG---------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
------------------


>BGISUSP0000894827
------YLDVLNDNTLPQVSCYITAPSSVLQLLECRIINSMSSLVVSDNEELVSNVITVECSEMEKRIPFPICIAIPFTARYRGNYRDIMVKVSDINFQS
SYLTPNSLEGMRGSYK------------------------------------------------------------------------------------
----------------------------------------------------------TKRTSIRKPGNTCESLKLLGFRSRDSGWFVLDGVVVRTTQSG
LISFELCEHL-FIVLRLSSIMENSHLLSFVKSLEEAMFSTTACIVLYHQKDNPHRVVILVVPSKDLNQELRHLRLGGLSGPPEPSRHFQVKEGEQLLLRF
TGNIFAS-NGKDYGKDYKLIFHLQRKPRLELQIKEVDEFGNYSCPHYKGTIIVYKVPKEKIVHNSDQSLILNENNYQLPICKLPLRLPK-----------
----------------------------------------------------------------------------------------------------
------