Sequences
EST Library Info
cst1Stomach - RNA from China
ebs2Foetus 50 days, brain stem
ecc1Foetus 50 days, cortex cerebri
pigca4Unavailable
pigcb2Unavailable
Clusters
Oligos
SNPs

Gene ID ENSG00000170004 (click for geneview)
Transcript ID ENST00000358181(link to ensembl)
Symbol CHD3
Localtion Chromosome:17:7732834:7755523:1 band: 17p13.1
Description Chromodomain helicase-DNA-binding protein 3 (CHD-3) (Mi-2 autoantigen 240 kDa protein) (Mi2-alpha). [Source:Uniprot/SWISSPROT;Acc:Q12873]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<-------------------------------------------------------------------------------------------------->
-M--K--A--A--D--T--V--I--L--W--A--R--S--K--N--D--Q--L--R--I--S--F--P--P--G--L--C--W--G--D--R--M--P--
ATGAAGGCGGCAGACACTGTGATCCTGTGGGCAAGAAGTAAAAATGACCAGCTGAGGATTTCTTTTCCTCCAGGACTGTGTTGGGGTGACAGGATGCCTG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

<---------------------------------------------------------------------------------------------------
D--K--D--D--I--R--L--L--P--S--A--L--G--V--K--K--R--K--R--G--P--K--K--Q--K--E--N--K--P--G--K--P--R--K
ATAAGGATGACATTCGGCTGCTGCCGTCAGCATTGGGTGTGAAGAAGAGAAAACGAGGACCCAAGAAGCAGAAGGAGAACAAGCCAGGAAAACCCCGAAA
  ::.:::::::::::::::::::: ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::.:::::::::::
--AAAGATGACATTCGGCTGCTGCCTTCAGCATTGGGTGTGAAGAAGAGAAAACGAGGACCCAAGAAGCAGAAGGAGAACAAGCCAGGGAAACCCCGAAA
---K--D--D--I--R--L--L--P--S--A--L--G--V--K--K--R--K--R--G--P--K--K--Q--K--E--N--K--P--G--K--P--R--K

------------><--------------------------------------------------------------------------------------
--R--K--K--R--D--S--E--E--E--F--G--S--E--R--D--E--Y--R--E--K--S--E--S--G--G--S--E--Y--G--T--G--P--G-
ACGCAAGAAGCGTGACAGTGAGGAGGAATTTGGTTCTGAGCGAGATGAGTACCGGGAGAAGTCAGAGAGTGGGGGCAGTGAATATGGAACCGGACCGGGT
::::::::::   :::::.::::::::::::::.:::::::::::::::::::::::::::::.::::::::.::::::::::::::::::::::: :::
ACGCAAGAAG---GACAGCGAGGAGGAATTTGGCTCTGAGCGAGATGAGTACCGGGAGAAGTCGGAGAGTGGAGGCAGTGAATATGGAACCGGACCCGGT
--R--K--K-----D--S--E--E--E--F--G--S--E--R--D--E--Y--R--E--K--S--E--S--G--G--S--E--Y--G--T--G--P--G-

-----------------------------------------------------------------------------------><---------------
-R--K--R--R--R--K--H--R--E--K--K--E--K--K--T--K--R--R--K--K--G--E--G--D--G--G--Q--K--Q--V--E--Q--K--
CGGAAACGAAGAAGGAAGCACCGAGAAAAAAAGGAGAAGAAGACAAAGCGGCGGAAAAAGGGGGAGGGAGATGGGGGGCAAAAGCAAGTGGAACAGAAGT
::::::::.:::::::::::::::::::::::..:.::.::.                                                          
CGGAAACGGAGAAGGAAGCACCGAGAAAAAAAAAAAAAAAAA----------------------------------------------------------
-R--K--R--R--R--K--H--R--E--K--K--K--K--K-----------------------------------------------------------

----------------------------------------------------------------------------------------------------
S--S--A--T--L--L--L--T--W--G--L--E--D--V--E--H--V--F--S--E--E--D--Y--H--T--L--T--N--Y--K--A--F--S--Q
CATCAGCAACTCTGCTTCTGACCTGGGGCCTGGAGGATGTGGAGCATGTGTTCTCTGAGGAGGATTACCACACGCTCACCAACTACAAAGCCTTCAGCCA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

--------><------------------------------------------------------------------------------------------
--F--M--R--P--L--I--A--K--K--N--P--K--I--P--M--S--K--M--M--T--I--L--G--A--K--W--R--E--F--S--A--N--N-
GTTCATGAGGCCCCTAATTGCTAAGAAGAATCCTAAGATCCCAATGTCTAAGATGATGACCATCCTTGGGGCCAAATGGAGAGAGTTCAGTGCCAACAAC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-P--F--K--G--S--A--A--A--V--A--A--A--A--A--A--A--A--A--A--V--A--E--Q--V--S--A--A--V--S--S--A--T--P--
CCCTTCAAGGGGTCAGCAGCTGCTGTGGCGGCGGCAGCGGCAGCAGCAGCAGCAGCTGTAGCTGAGCAGGTGTCAGCTGCTGTCTCGTCGGCCACCCCCA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

--------------------------------------------------------------------------------------------><------
I--A--P--S--G--P--P--A--L--P--P--P--P--A--A--D--I--Q--P--P--P--I--R--R--A--K--T--K--E--G--K--G--P--G
TAGCACCCTCCGGACCCCCCGCCCTTCCACCACCCCCTGCTGCTGATATCCAGCCCCCACCCATCCGAAGAGCCAAAACCAAAGAGGGCAAAGGTCCAGG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--H--K--R--R--S--K--S--P--R--V--P--D--G--R--K--K--L--R--G--K--K--M--A--P--L--K--I--K--L--G--L--L--G-
CCATAAGAGGCGGAGTAAGAGCCCCCGAGTGCCTGATGGACGCAAGAAGCTTCGGGGAAAGAAAATGGCACCACTCAAAATAAAACTAGGGCTTCTGGGT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-----------------------><---------------------------------------------------------------------------
-G--K--R--K--K--G--G--S--Y--V--F--Q--S--D--E--G--P--E--P--E--A--E--E--S--D--L--D--S--G--S--V--H--S--
GGCAAGAGGAAGAAAGGAGGCTCGTATGTTTTTCAGAGCGACGAAGGTCCTGAACCAGAGGCTGAGGAATCAGACCTGGACAGTGGCAGTGTCCACAGTG
                        :::::::: :::::::::::.::.::.::::: :::::::::::.::::::::::::::.::::::::::::::::
------------------------TATGTTTTGCAGAGCGACGAGGGCCCCGAACCCGAGGCTGAGGAGTCAGACCTGGACAGCGGCAGTGTCCACAGTG
-------------------------Y--V--L--Q--S--D--E--G--P--E--P--E--A--E--E--S--D--L--D--S--G--S--V--H--S--

--------------------------------------------------------------------------><------------------------
A--S--G--R--P--D--G--P--V--R--T--K--K--L--K--R--G--R--P--G--R--K--K--K--K--V--L--G--C--P--A--V--A--G
CCTCAGGCCGGCCTGATGGCCCTGTCCGCACCAAGAAACTAAAGAGAGGCCGGCCAGGAAGGAAGAAGAAGAAGGTCCTGGGCTGTCCTGCAGTGGCCGG
:::::::::::::.::::::::.:::::::::::::::::::::::::::::::::::: ::::::::::::::   :::::::::::.:::::::::::
CCTCAGGCCGGCCCGATGGCCCCGTCCGCACCAAGAAACTAAAGAGAGGCCGGCCAGGACGGAAGAAGAAGAAG---CTGGGCTGTCCCGCAGTGGCCGG
A--S--G--R--P--D--G--P--V--R--T--K--K--L--K--R--G--R--P--G--R--K--K--K--K-----L--G--C--P--A--V--A--G

----------------------------------------------------------------------------------------------------
--E--E--E--V--D--G--Y--E--T--D--H--Q--D--Y--C--E--V--C--Q--Q--G--G--E--I--I--L--C--D--T--C--P--R--A-
GGAGGAGGAGGTTGATGGCTACGAGACGGATCACCAGGATTACTGTGAGGTGTGCCAGCAGGGTGGGGAAATTATTCTGTGTGACACCTGCCCTCGTGCC
::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
GGAGGAGGAGGTTGATGGCTACGAGACGGATCACCAGGATTACTGTGAGGTGTGCCAGCAGGGTGGGGAAATTATTCTGTGTGACACCTGCCCTCGTGCC
--E--E--E--V--D--G--Y--E--T--D--H--Q--D--Y--C--E--V--C--Q--Q--G--G--E--I--I--L--C--D--T--C--P--R--A-

--------------------------------------------------------------------><------------------------------
-Y--H--L--V--C--L--D--P--E--L--D--R--A--P--E--G--K--W--S--C--P--H--C--E--K--E--G--V--Q--W--E--A--K--
TACCACCTCGTCTGCCTTGATCCTGAGCTTGACCGGGCTCCAGAGGGCAAATGGAGCTGCCCTCACTGTGAGAAGGAGGGGGTCCAGTGGGAGGCCAAGG
::::::::::::::::::::::::::::::::::::::::: ::::::::.:::::::::::.::::::::::::::::: ::.::::::::::: ::::
TACCACCTCGTCTGCCTTGATCCTGAGCTTGACCGGGCTCCTGAGGGCAAGTGGAGCTGCCCCCACTGTGAGAAGGAGGGCGTTCAGTGGGAGGCAAAGG
-Y--H--L--V--C--L--D--P--E--L--D--R--A--P--E--G--K--W--S--C--P--H--C--E--K--E--G--V--Q--W--E--A--K--

----------------------------------------------------------------------------------------------------
E--E--E--E--E--Y--E--E--E--G--E--E--E--G--E--K--E--E--E--D--D--H--M--E--Y--C--R--V--C--K--D--G--G--E
AGGAAGAAGAAGAATACGAAGAGGAGGGAGAGGAAGAAGGGGAGAAGGAGGAGGAGGATGATCACATGGAGTACTGCCGCGTATGCAAGGACGGCGGGGA
::::.:: :: :: ::::::::::::::::::::.:::::::::::::::::::::::.::.::::::::::::::::::::.:::::::::::::: ::
AGGAGGATGACGACTACGAAGAGGAGGGAGAGGAGGAAGGGGAGAAGGAGGAGGAGGACGACCACATGGAGTACTGCCGCGTGTGCAAGGACGGCGGCGA
E--E--D--D--D--Y--E--E--E--G--E--E--E--G--E--K--E--E--E--D--D--H--M--E--Y--C--R--V--C--K--D--G--G--E

----------------------------------------------------------------------------------------------------
--L--L--C--C--D--A--C--I--S--S--Y--H--I--H--C--L--N--P--P--L--P--D--I--P--N--G--E--W--L--C--P--R--C-
GCTCCTGTGCTGTGACGCGTGCATCTCCTCCTACCACATTCATTGTCTAAACCCTCCCCTGCCTGACATTCCCAATGGTGAATGGCTGTGTCCCCGATGC
::: ::::::::.::.:: ::::::::::::::::::::.::.::.::.::::: ::::::::.:::::.:::::.::::::::::::::::::::::::
GCTGCTGTGCTGCGATGCCTGCATCTCCTCCTACCACATCCACTGCCTGAACCCGCCCCTGCCCGACATCCCCAACGGTGAATGGCTGTGTCCCCGATGC
--L--L--C--C--D--A--C--I--S--S--Y--H--I--H--C--L--N--P--P--L--P--D--I--P--N--G--E--W--L--C--P--R--C-

--><------------------------------------------------------------------------------------------------
-T--C--P--V--L--K--G--R--V--Q--K--I--L--H--W--R--W--G--E--P--P--V--A--V--P--A--P--Q--Q--A--D--G--N--
ACATGCCCCGTGCTGAAGGGTCGAGTGCAGAAGATCCTACATTGGCGGTGGGGGGAGCCACCTGTAGCAGTGCCAGCCCCTCAACAGGCAGATGGAAATC
:::::.::.::::::::.::.:: ::::::::::::::.::.::::::::::::::::::::.::.::::::::::::::.::::::::::::::.::::
ACATGTCCTGTGCTGAAAGGCCGTGTGCAGAAGATCCTGCACTGGCGGTGGGGGGAGCCACCCGTGGCAGTGCCAGCCCCCCAACAGGCAGATGGGAATC
-T--C--P--V--L--K--G--R--V--Q--K--I--L--H--W--R--W--G--E--P--P--V--A--V--P--A--P--Q--Q--A--D--G--N--

----------------------------------------------------------------------------------------------------
P--D--V--P--P--P--R--P--L--Q--G--R--S--E--R--E--F--F--V--K--W--V--G--L--S--Y--W--H--C--S--W--A--K--E
CAGATGTCCCACCCCCCCGTCCTCTTCAAGGCAGATCAGAGCGAGAGTTCTTTGTCAAGTGGGTAGGACTATCCTACTGGCACTGCTCCTGGGCCAAGGA
:.::::.::::::::: :::::.:::::::::::.::.::::::::::::::::::::::::::::::::.:::::::::::.:::::::::::::::::
CGGATGCCCCACCCCCACGTCCCCTTCAAGGCAGGTCGGAGCGAGAGTTCTTTGTCAAGTGGGTAGGACTGTCCTACTGGCATTGCTCCTGGGCCAAGGA
P--D--A--P--P--P--R--P--L--Q--G--R--S--E--R--E--F--F--V--K--W--V--G--L--S--Y--W--H--C--S--W--A--K--E

------><--------------------------------------------------------------------------------------------
--L--Q--L--E--I--F--H--L--V--M--Y--R--N--Y--Q--R--K--N--D--M--D--E--P--P--P--L--D--Y--G--S--G--E--D-
GCTTCAGCTGGAAATCTTCCATTTGGTTATGTATCGAAACTACCAGCGGAAGAATGACATGGATGAGCCCCCACCCCTGGACTATGGCTCCGGCGAGGAT
::::::::::::.::::::::.:::::.:::::.::.::::::::.::::::::.:::::::::::::::::.:::::::::::::::::.:: ::::::
GCTTCAGCTGGAGATCTTCCACTTGGTCATGTACCGGAACTACCAACGGAAGAACGACATGGATGAGCCCCCGCCCCTGGACTATGGCTCTGGGGAGGAT
--L--Q--L--E--I--F--H--L--V--M--Y--R--N--Y--Q--R--K--N--D--M--D--E--P--P--P--L--D--Y--G--S--G--E--D-

----------------------------------------------------------------------------------------------------
-D--G--K--S--D--K--R--K--V--K--D--P--H--Y--A--E--M--E--E--K--Y--Y--R--F--G--I--K--P--E--W--M--T--V--
GATGGGAAGAGCGACAAGCGTAAAGTGAAAGACCCGCACTATGCTGAGATGGAGGAGAAGTACTATCGTTTTGGCATCAAGCCAGAGTGGATGACCGTCC
::.::::::::.::::::::.::.:::::.:::::::::::.::.:::::::::::::::::::::::.:::::::::::::: ::::::::::::::::
GACGGGAAGAGTGACAAGCGCAAGGTGAAGGACCCGCACTACGCCGAGATGGAGGAGAAGTACTATCGCTTTGGCATCAAGCCCGAGTGGATGACCGTCC
-D--G--K--S--D--K--R--K--V--K--D--P--H--Y--A--E--M--E--E--K--Y--Y--R--F--G--I--K--P--E--W--M--T--V--

------------------><--------------------------------------------------------------------------------
H--R--I--I--N--H--S--V--D--K--K--G--N--Y--H--Y--L--V--K--W--R--D--L--P--Y--D--Q--S--T--W--E--E--D--E
ACCGCATCATCAACCACAGTGTGGATAAAAAGGGGAATTACCACTATCTAGTAAAATGGAGGGACTTACCATATGACCAGTCCACGTGGGAGGAAGATGA
:::: ::::::::::::   ::::::::::::::::::::::::::::::::.::::::::::::::.:: ::::::::::::::.::::::::::::::
ACCGGATCATCAACCAC---GTGGATAAAAAGGGGAATTACCACTATCTAGTGAAATGGAGGGACTTGCCCTATGACCAGTCCACATGGGAGGAAGATGA
H--R--I--I--N--H-----V--D--K--K--G--N--Y--H--Y--L--V--K--W--R--D--L--P--Y--D--Q--S--T--W--E--E--D--E

--------------------------------------------------><------------------------------------------------
--M--N--I--P--E--Y--E--E--H--K--Q--S--Y--W--R--H--R--E--L--I--M--G--E--D--P--A--Q--P--R--K--Y--K--K-
AATGAATATCCCTGAATACGAAGAACATAAGCAAAGCTACTGGAGACACCGAGAACTAATTATGGGGGAAGACCCTGCCCAGCCCCGCAAGTATAAGAAG
::::::.:::::::::::.::::: ::.:::::::::::::::::::::   ::::: :::::::::::.:::::.::::::::::::::::::::::::
AATGAACATCCCTGAATATGAAGACCACAAGCAAAGCTACTGGAGACAC---GAACTCATTATGGGGGAGGACCCCGCCCAGCCCCGCAAGTATAAGAAG
--M--N--I--P--E--Y--E--D--H--K--Q--S--Y--W--R--H-----E--L--I--M--G--E--D--P--A--Q--P--R--K--Y--K--K-

--------------------------------------------------><------------------------------------------------
-K--K--K--E--L--Q--G--D--G--P--P--S--S--P--T--N--D--P--T--V--K--Y--E--T--Q--P--R--F--I--T--A--T--G--
AAGAAGAAGGAGCTACAGGGTGATGGGCCTCCCAGTTCTCCCACTAATGATCCTACCGTGAAATATGAGACTCAGCCACGGTTTATCACAGCCACTGGAG
:::::::::::.::.:::::.::.:::::::::::::::::::::::.:::::::: ::::::::.::::: ::::: ::::.::::::::::::.::::
AAGAAGAAGGAACTGCAGGGCGACGGGCCTCCCAGTTCTCCCACTAACGATCCTACAGTGAAATACGAGACACAGCCCCGGTCTATCACAGCCACCGGAG
-K--K--K--E--L--Q--G--D--G--P--P--S--S--P--T--N--D--P--T--V--K--Y--E--T--Q--P--R--S--I--T--A--T--G--

----------------------------------------------------------------------------------------------------
G--T--L--H--M--Y--Q--L--E--G--L--N--W--L--R--F--S--W--A--Q--G--T--D--T--I--L--A--D--E--M--G--L--G--K
GCACCCTGCACATGTATCAGTTGGAAGGGCTGAACTGGCTACGCTTCTCCTGGGCCCAGGGCACTGACACCATTCTAGCTGATGAGATGGGGCTAGGCAA
:::: ::::::.::::::::.::::::::.::::::::::::::::::: :::::::::::::: :::::::::::.:::::::::::::::::.:::::
GCACGCTGCACGTGTATCAGCTGGAAGGGTTGAACTGGCTACGCTTCTCGTGGGCCCAGGGCACAGACACCATTCTGGCTGATGAGATGGGGCTGGGCAA
G--T--L--H--V--Y--Q--L--E--G--L--N--W--L--R--F--S--W--A--Q--G--T--D--T--I--L--A--D--E--M--G--L--G--K

------------------------------------------><--------------------------------------------------------
--T--I--Q--T--I--V--F--L--Y--S--L--Y--K--E--G--H--T--K--G--P--F--L--V--S--A--P--L--S--T--I--I--N--W-
GACCATACAAACCATCGTCTTCCTCTACTCACTCTACAAGGAGGGCCACACAAAAGGTCCCTTCCTGGTGAGTGCCCCACTCTCTACCATCATTAACTGG
::::.::::::::::::::::::::::::: :::::.::::::::::::::.::.::::::::.:::::::::::.::::::::::::::::::::::::
GACCGTACAAACCATCGTCTTCCTCTACTCTCTCTATAAGGAGGGCCACACGAAGGGTCCCTTTCTGGTGAGTGCTCCACTCTCTACCATCATTAACTGG
--T--V--Q--T--I--V--F--L--Y--S--L--Y--K--E--G--H--T--K--G--P--F--L--V--S--A--P--L--S--T--I--I--N--W-

----------------------------------------------------------------------------------------------------
-E--R--E--F--Q--M--W--A--P--K--F--Y--V--V--T--Y--T--G--D--K--D--S--R--A--I--I--R--E--N--E--F--S--F--
GAGCGGGAGTTCCAGATGTGGGCACCCAAATTCTATGTGGTGACATACACGGGTGACAAGGACAGCCGGGCCATCATTCGTGAGAATGAATTCTCCTTTG
:::::::::::::::::::::::::: ::.:. ::::::::::::::::::::::::::::::::::::::::::::::::::::::::.::.:::::::
GAGCGGGAGTTCCAGATGTGGGCACCGAAGTC-TATGTGGTGACATACACGGGTGACAAGGACAGCCGGGCCATCATTCGTGAGAATGAGTTTTCCTTTG
-E--R--E--F--Q--M--W--A--P--K--F--Y--V--V--T--Y--T--G--D--K--D--S--R--A--I--I--R--E--N--E--F--S--F--

----------------------------------------------><----------------------------------------------------
E--D--N--A--I--K--G--G--K--K--A--F--K--M--K--R--E--A--Q--V--K--F--H--V--L--L--T--S--Y--E--L--I--T--I
AGGACAATGCCATCAAAGGGGGCAAGAAAGCTTTTAAGATGAAGAGGGAGGCACAGGTGAAGTTCCATGTTCTCCTGACATCGTATGAGCTGATCACCAT
:.:::::.::::::::::: ::::::::::::::.::::::::::::::::: ::::::::::::::.::::::::::::::.:::::::::::::::::
AAGACAACGCCATCAAAGGTGGCAAGAAAGCTTTCAAGATGAAGAGGGAGGCCCAGGTGAAGTTCCACGTTCTCCTGACATCATATGAGCTGATCACCAT
E--D--N--A--I--K--G--G--K--K--A--F--K--M--K--R--E--A--Q--V--K--F--H--V--L--L--T--S--Y--E--L--I--T--I

------------------------------------------------------------------------------------><--------------
--D--Q--A--A--L--G--S--I--R--W--A--C--L--V--V--D--E--A--H--R--L--K--N--N--Q--S--K--F--F--R--V--L--N-
TGATCAGGCAGCACTTGGTTCCATCCGCTGGGCCTGTCTTGTGGTAGATGAGGCCCATCGACTCAAGAACAACCAGTCCAAGTTTTTCAGGGTTCTCAAT
::::::::::::.:::::.::::::::::::::::::::.:::::.:::::.::::::::.:::::::::::::::::::::                  
TGATCAGGCAGCGCTTGGCTCCATCCGCTGGGCCTGTCTCGTGGTGGATGAAGCCCATCGGCTCAAGAACAACCAGTCCAAG------------------
--D--Q--A--A--L--G--S--I--R--W--A--C--L--V--V--D--E--A--H--R--L--K--N--N--Q--S--K-------------------

----------------------------------------------------------------------------------------------------
-G--Y--K--I--D--H--K--L--L--L--T--G--T--P--L--Q--N--N--L--E--E--L--F--H--L--L--N--F--L--T--P--E--R--
GGTTACAAGATAGATCATAAGTTGCTGCTGACAGGAACCCCATTGCAGAATAATCTGGAGGAGCTCTTCCATCTCCTGAACTTCCTCACCCCAGAGAGAT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

------><--------------------------------------------------------------------------------------------
F--N--N--L--E--G--F--L--E--E--F--A--D--I--S--K--E--D--Q--I--K--K--L--H--D--L--L--G--P--H--M--L--R--R
TTAACAACTTGGAGGGCTTCCTGGAGGAGTTTGCTGACATATCCAAAGAGGACCAGATCAAGAAACTGCATGATTTGCTGGGGCCACACATGCTGCGGAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

--------------------------------------------------------------------------------><------------------
--L--K--A--D--V--F--K--N--M--P--A--K--T--E--L--I--V--R--V--E--L--S--P--M--Q--K--K--Y--Y--K--Y--I--L-
ACTCAAGGCAGATGTCTTTAAGAACATGCCAGCCAAGACAGAGCTCATCGTTCGGGTGGAGCTAAGCCCCATGCAGAAGAAATACTACAAATACATCCTG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-T--R--N--F--E--A--L--N--S--R--G--G--G--N--Q--V--S--L--L--N--I--M--M--D--L--K--K--C--C--N--H--P--Y--
ACTCGAAATTTTGAGGCCTTGAATTCACGAGGTGGTGGGAACCAGGTGTCGCTGCTTAATATCATGATGGATCTTAAGAAGTGCTGCAACCATCCATACC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------><----------------------------------------------------------------------------
L--F--P--V--A--A--M--E--S--P--K--L--P--S--G--A--Y--E--G--G--A--L--I--K--S--S--G--K--L--M--L--L--Q--K
TTTTTCCCGTGGCTGCTATGGAGTCCCCCAAACTCCCCAGTGGGGCTTATGAGGGTGGGGCACTTATTAAGTCGTCTGGGAAGCTCATGCTGCTCCAGAA
                                                                                         ::::: :::::
-----------------------------------------------------------------------------------------CTGCTGCAGAA
------------------------------------------------------------------------------------------L--L--Q--K

------------------------------------------------------><--------------------------------------------
--M--L--R--K--L--K--E--Q--G--H--R--V--L--I--F--S--Q--M--T--K--M--L--D--L--L--E--D--F--L--D--Y--E--G-
GATGCTGCGAAAGCTGAAGGAGCAAGGACACCGAGTGCTCATCTTCTCGCAGATGACCAAAATGTTAGACTTGCTTGAGGACTTCTTAGACTATGAAGGC
:::::::::.::::: ::::::::::::::: ::::::::::::::::::::::::::::::::::::::::::: :::::::::.: :::::.::::::
GATGCTGCGGAAGCTCAAGGAGCAAGGACACAGAGTGCTCATCTTCTCGCAGATGACCAAAATGTTAGACTTGCTAGAGGACTTCCTCGACTACGAAGGC
--M--L--R--K--L--K--E--Q--G--H--R--V--L--I--F--S--Q--M--T--K--M--L--D--L--L--E--D--F--L--D--Y--E--G-

------------------------------------------------------------------------><--------------------------
-Y--K--Y--E--R--I--D--G--G--I--T--G--A--L--R--Q--E--A--I--D--R--F--N--A--P--G--A--Q--Q--F--C--F--L--
TACAAGTATGAGCGCATCGATGGTGGTATCACGGGTGCCCTGAGGCAGGAGGCCATCGATCGGTTTAATGCTCCTGGGGCCCAACAATTCTGCTTCCTCC
::::::::::::::::::::::::::.::::: ::.:::::::::::::::::::::::.:: ::::::   :::::::::::.::::::::::::::::
TACAAGTATGAGCGCATCGATGGTGGCATCACTGGCGCCCTGAGGCAGGAGGCCATCGACCGCTTTAAT---CCTGGGGCCCAGCAATTCTGCTTCCTCC
-Y--K--Y--E--R--I--D--G--G--I--T--G--A--L--R--Q--E--A--I--D--R--F--N-----P--G--A--Q--Q--F--C--F--L--

-------------------------------------------------------------------------------------------------><-
L--S--T--R--A--G--G--L--G--I--N--L--A--T--A--D--T--V--I--I--F--D--S--D--W--N--P--H--N--D--I--Q--A--F
TGTCCACCCGAGCTGGGGGCCTGGGCATCAATCTGGCCACTGCTGACACTGTCATCATCTTTGATTCTGACTGGAACCCCCATAATGACATCCAGGCCTT
::::.:::::::::::.::::::::::::::::: ::::: :: ::::::::::::::::::::::::::::::::::::::::::::::::::::::::
TGTCTACCCGAGCTGGAGGCCTGGGCATCAATCTCGCCACAGCAGACACTGTCATCATCTTTGATTCTGACTGGAACCCCCATAATGACATCCAGGCCTT
L--S--T--R--A--G--G--L--G--I--N--L--A--T--A--D--T--V--I--I--F--D--S--D--W--N--P--H--N--D--I--Q--A--F

----------------------------------------------------------------------------------------------------
--S--R--A--H--R--I--G--Q--A--N--K--V--M--I--Y--R--F--V--T--R--A--S--V--E--E--R--I--T--Q--V--A--K--R-
TAGCCGGGCTCATCGGATTGGCCAGGCCAACAAAGTGATGATTTACCGGTTTGTGACTCGCGCGTCAGTGGAAGAGCGAATCACACAAGTGGCCAAGAGA
.::::: :::::::::::.:::::::::::::::::::::::::::::.::::::::::::::.::::::::::::::.::::::::.::::::::: ::
CAGCCGTGCTCATCGGATCGGCCAGGCCAACAAAGTGATGATTTACCGATTTGTGACTCGCGCATCAGTGGAAGAGCGGATCACACAGGTGGCCAAGCGA
--S--R--A--H--R--I--G--Q--A--N--K--V--M--I--Y--R--F--V--T--R--A--S--V--E--E--R--I--T--Q--V--A--K--R-

----------------------------------------------------------------------------------------------------
-K--M--M--L--T--H--L--V--V--R--P--G--L--G--S--K--A--G--S--M--S--K--Q--E--L--D--D--I--L--K--F--G--T--
AAGATGATGCTGACACACCTGGTTGTGCGGCCTGGGCTGGGCTCCAAGGCAGGCTCCATGTCCAAGCAGGAGCTTGACGACATTCTCAAATTTGGCACTG
::::::::::::::::::::::: ::::::::.::::::::::::::::::::::::::::::::::::::::: ::::::::.::::::::::::::::
AAGATGATGCTGACACACCTGGTGGTGCGGCCCGGGCTGGGCTCCAAGGCAGGCTCCATGTCCAAGCAGGAGCTGGACGACATCCTCAAATTTGGCACTG
-K--M--M--L--T--H--L--V--V--R--P--G--L--G--S--K--A--G--S--M--S--K--Q--E--L--D--D--I--L--K--F--G--T--

-----------------------------><---------------------------------------------------------------------
E--E--L--F--K--D--E--N--E--G--E--N--K--E--E--D--S--S--V--I--H--Y--D--N--E--A--I--A--R--L--L--D--R--N
AAGAGCTATTCAAGGATGAAAACGAGGGGGAGAACAAGGAGGAGGACAGCAGTGTGATTCATTATGACAATGAGGCCATCGCTCGGCTGTTGGACCGGAA
:.::::::::.:::::::::::.:::                                                                          
AGGAGCTATTTAAGGATGAAAATGAG--------------------------------------------------------------------------
E--E--L--F--K--D--E--N--E---------------------------------------------------------------------------

------------------------------------------------------------------------------------------------><--
--Q--D--A--T--E--D--T--D--V--Q--N--M--N--E--Y--L--S--S--F--K--V--A--Q--Y--V--V--R--E--E--D--K--I--E-
CCAGGATGCAACTGAGGACACTGACGTGCAGAACATGAATGAGTATCTCAGCTCCTTCAAGGTGGCACAGTACGTCGTGCGGGAAGAAGACAAGATTGAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-E--I--E--R--E--I--I--K--Q--E--E--N--V--D--P--D--Y--W--E--K--L--L--R--H--H--Y--E--Q--Q--Q--E--D--L--
GAAATTGAGCGAGAGATCATCAAGCAGGAGGAGAATGTGGACCCTGACTACTGGGAGAAGCTGCTGAGGCATCACTATGAGCAACAGCAGGAAGACCTAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

--------------------------------------------------------------------------><------------------------
A--R--N--L--G--K--G--K--R--V--R--K--Q--V--N--Y--N--D--A--A--Q--E--D--Q--D--N--Q--S--E--Y--S--V--G--S
CCCGGAATCTAGGCAAGGGCAAGCGGGTTCGCAAGCAAGTTAACTACAATGATGCTGCTCAGGAAGACCAAGACAACCAGTCAGAGTACTCGGTGGGTTC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------><----------------------------------------------------------
--E--E--E--D--E--D--F--D--E--R--P--E--G--R--R--Q--S--K--R--Q--L--R--N--E--K--D--K--P--L--P--P--L--L-
AGAGGAGGAGGATGAAGACTTCGATGAACGTCCTGAAGGGCGTAGACAGTCAAAGAGGCAGCTCCGGAATGAGAAAGATAAGCCACTGCCTCCACTGCTG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

--------------------------><------------------------------------------------------------------------
-A--R--V--G--G--N--I--E--V--L--G--F--N--T--R--Q--R--K--A--F--L--N--A--V--M--R--W--G--M--P--P--Q--D--
GCCCGAGTCGGGGGCAACATTGAGGTGCTGGGCTTCAACACCCGTCAGCGGAAGGCTTTCCTCAATGCTGTGATGCGCTGGGGGATGCCACCACAGGATG
                                          ::::::::::::::.::::::::.::.:::::::::::::: :::::.::.:::::.:
------------------------------------------CGTCAGCGGAAGGCCTTCCTCAACGCCGTGATGCGCTGGGGCATGCCGCCGCAGGACG
-------------------------------------------R--Q--R--K--A--F--L--N--A--V--M--R--W--G--M--P--P--Q--D--

------------------------------------------------------------><--------------------------------------
A--F--T--T--Q--W--L--V--R--D--L--R--G--K--T--E--K--E--F--K--A--Y--V--S--L--F--M--R--H--L--C--E--P--G
CCTTCACCACACAGTGGCTGGTGCGGGACCTGAGGGGCAAGACTGAGAAGGAGTTTAAGGCCTATGTGTCTTTGTTCATGCGCCATCTGTGTGAGCCTGG
:::::::::: :::::::::::::: ::::::::::::::::: :::::::::      ::::::::::::::::::::::::::::: ::::::::.::
CCTTCACCACCCAGTGGCTGGTGCGCGACCTGAGGGGCAAGACGGAGAAGGAG------GCCTATGTGTCTTTGTTCATGCGCCATCTCTGTGAGCCCGG
A--F--T--T--Q--W--L--V--R--D--L--R--G--K--T--E--K--E--------A--Y--V--S--L--F--M--R--H--L--C--E--P--G

----------------------------------------------------------------------------------------------------
--A--D--G--S--E--T--F--A--D--G--V--P--R--E--G--L--S--R--Q--Q--V--L--T--R--I--G--V--M--S--L--V--K--K-
GGCAGACGGCTCTGAAACCTTTGCCGATGGGGTCCCTCGGGAGGGACTGAGTCGCCAGCAGGTGTTGACCCGCATTGGAGTCATGTCTCTCGTCAAAAAG
:::::::::::::::::::::::: ::.::::::::::::::::::::::::::::::::.:::::::::::::::::::::::::: ::::::::.:::
GGCAGACGGCTCTGAAACCTTTGCGGACGGGGTCCCTCGGGAGGGACTGAGTCGCCAGCAAGTGTTGACCCGCATTGGAGTCATGTCACTCGTCAAGAAG
--A--D--G--S--E--T--F--A--D--G--V--P--R--E--G--L--S--R--Q--Q--V--L--T--R--I--G--V--M--S--L--V--K--K-

-----><---------------------------------------------------------------------------------------------
-K--V--Q--E--F--E--H--I--N--G--R--W--S--M--P--E--L--M--P--D--P--S--A--D--S--K--R--S--S--R--A--S--S--
AAGGTGCAGGAGTTTGAGCACATCAATGGGCGTTGGTCAATGCCGGAACTGATGCCTGACCCCAGCGCCGATTCTAAGCGCTCCTCCAGAGCCTCCTCTC
::::: ::::::::::::::::::::.:::::.::::: ::::::::.::::::::::::::::::::.::.::.:::::::::::::::::::::::::
AAGGTTCAGGAGTTTGAGCACATCAACGGGCGCTGGTCTATGCCGGAGCTGATGCCTGACCCCAGCGCTGACTCCAAGCGCTCCTCCAGAGCCTCCTCTC
-K--V--Q--E--F--E--H--I--N--G--R--W--S--M--P--E--L--M--P--D--P--S--A--D--S--K--R--S--S--R--A--S--S--

--------------------------------------------------------------------><------------------------------
P--T--K--T--S--P--T--T--P--E--A--S--A--T--N--S--P--C--T--S--K--P--A--T--P--A--P--S--E--K--G--E--G--I
CTACCAAAACGTCTCCCACCACTCCTGAGGCTTCTGCTACCAACAGTCCCTGCACCTCTAAACCTGCTACTCCAGCTCCAAGTGAGAAAGGAGAAGGCAT
:::::::.:: ::.::::::::::::::::::::::::.::::::::::.:::::::: .::      ::::::::::::::::::::::::::.:::::
CTACCAAGACCTCCCCCACCACTCCTGAGGCTTCTGCTGCCAACAGTCCTTGCACCTCAGAA------ACTCCAGCTCCAAGTGAGAAAGGAGAGGGCAT
P--T--K--T--S--P--T--T--P--E--A--S--A--A--N--S--P--C--T--S--E--------T--P--A--P--S--E--K--G--E--G--M

------------------------------------------------------------------------------------------><--------
--R--T--P--L--E--K--E--E--A--E--N--Q--E--E--K--P--E--K--N--S--R--I--G--E--K--M--E--T--E--A--D--A--P-
AAGGACACCTCTTGAGAAGGAGGAAGCTGAAAACCAGGAGGAAAAGCCAGAGAAGAACAGCAGAATTGGGGAGAAGATGGAGACAGAGGCTGATGCCCCC
.::::::::::: :::::::: ::::: :::: :::::::::.:::::::.:::.:: :. :.:                                    
GAGGACACCTCTGGAGAAGGATGAAGCAGAAATCCAGGAGGAGAAGCCAGGGAAAAAAAAAAAA------------------------------------
--R--T--P--L--E--K--D--E--A--E--I--Q--E--E--K--P--G--K--K--K--K-------------------------------------

----------------------------------------------------------------------------------------------------
-S--P--A--P--S--L--G--E--R--L--E--P--R--K--I--P--L--E--D--E--V--P--G--V--P--G--E--M--E--P--E--P--G--
AGCCCAGCCCCATCACTTGGGGAGCGGCTGGAGCCAAGGAAGATTCCTCTAGAGGATGAGGTGCCAGGGGTGCCTGGAGAGATGGAGCCTGAACCTGGGT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

--------------------------><------------------------------------------------------------------------
Y--R--G--D--R--E--K--S--E--D--V--K--G--D--R--E--L--R--P--G--P-----R--D--E--P--R--S--N--G--R--R--E--E
ACCGTGGGGACAGAGAGAAGTCAGAAGATGTAAAAGGTGACCGGGAGCTTCGACCAGGGCCT---CGAGATGAGCCACGGTCCAATGGGCGACGAGAGGA
                          ::.::.::::: :::::::::::.::::: ::::::   :::::.::::..::::::::::::::::: :::::
--------------------------GACGTGAAAGGGGACCGGGAGCTCCGACCTGGGCCTCCTCGAGACGAGCTGCGGTCCAATGGGCGACGCGAGGA
---------------------------D--V--K--G--D--R--E--L--R--P--G--P--P--R--D--E--L--R--S--N--G--R--R--E--E

-------------------------------------------------------><-------------------------------------------
--K--T--E--K--P--R--F--M--F--N--I--A--D--G--G--F--T--E--L--H--T--L--W--Q--N--E--E--R--A--A--I--S--S-
AAAGACAGAGAAGCCCCGGTTCATGTTCAATATCGCCGATGGTGGCTTCACAGAGCTTCACACACTGTGGCAGAATGAGGAACGGGCAGCTATTTCCTCG
.:::...:::::::: ::::::::::::::.::.:: ::.::::::::::::   :::::::::::::::::::::::::::::::::::::::::::::
GAAGGTGGAGAAGCCGCGGTTCATGTTCAACATTGCAGACGGTGGCTTCACA---CTTCACACACTGTGGCAGAATGAGGAACGGGCAGCTATTTCCTCG
--K--V--E--K--P--R--F--M--F--N--I--A--D--G--G--F--T-----L--H--T--L--W--Q--N--E--E--R--A--A--I--S--S-

----------------------------------------------------------------><----------------------------------
-G--K--L--N--E--I--W--H--R--R--H--D--Y--W--L--L--A--G--I--V--L--H--G--Y--A--R--W--Q--D-----I--Q--N--
GGGAAACTCAATGAGATCTGGCACAGAAGACATGACTATTGGCTTCTGGCTGGGATTGTCCTCCATGGCTATGCACGGTGGCAGGAC---ATCCAGAATG
:::::::::::::::::::::::: :::::::::::::::::::::::::::::::::::   ::::::::.:::::::::::::::   ::::::::.:
GGGAAACTCAATGAGATCTGGCACCGAAGACATGACTATTGGCTTCTGGCTGGGATTGTC---CATGGCTACGCACGGTGGCAGGACG--ATCCAGAACG
-G--K--L--N--E--I--W--H--R--R--H--D--Y--W--L--L--A--G--I--V-----H--G--Y--A--R--W--Q--D--\--I--Q--N--

----------------------------------------------------------------------------------------------------
D--A--Q--F--A--I--I--N--E--P--F--K--T--E--A--N--K--G--N--F--L--E--M--K--N--K--F--L--A--R--R--F--K--L
ATGCTCAATTTGCCATTATCAACGAGCCATTTAAAACTGAAGCCAATAAGGGGAACTTTCTGGAGATGAAAAATAAGTTCCTGGCCCGGAGGTTCAAGCT
:::::::.:::::::::::::::::::::::::::::::::::.:::::::::::::::::::::::::::::::::::::::::::::::.::::::::
ATGCTCAGTTTGCCATTATCAACGAGCCATTTAAAACTGAAGCTAATAAGGGGAACTTTCTGGAGATGAAAAATAAGTTCCTGGCCCGGAGATTCAAGCT
D--A--Q--F--A--I--I--N--E--P--F--K--T--E--A--N--K--G--N--F--L--E--M--K--N--K--F--L--A--R--R--F--K--L

><--------------------------------------------------------------------------------------------------
--L--E--Q--A--L--V--I--E--E--Q--L--R--R--A--A--Y--L--N--L--S--Q--E--P--A--H--P-----A--M--A--L--H--A-
CCTGGAGCAGGCGCTGGTGATTGAGGAGCAGCTGCGGCGGGCGGCCTACCTGAACCTGTCGCAGGAGCCGGCGCACCCC---GCCATGGCCCTCCACGCC
:::::::::::::::::::::.:::::::::::::::::::::::::::::::::::.::.::::::::::::::::::   ::::::::::::::::::
CCTGGAGCAGGCGCTGGTGATCGAGGAGCAGCTGCGGCGGGCGGCCTACCTGAACCTATCACAGGAGCCGGCGCACCCCT--GCCATGGCCCTCCACGCC
--L--E--Q--A--L--V--I--E--E--Q--L--R--R--A--A--Y--L--N--L--S--Q--E--P--A--H--P--\--A--M--A--L--H--A-

--------------------------------------------------------------------------------------------------->
-R--F--A--E--A--E--C--L--A--E--S--H--Q--H--L--S--K--E--S--L--A--G--N--K--P--A--N--A--V--L--H--K--V--
CGCTTCGCCGAGGCCGAGTGCCTGGCCGAGAGCCACCAGCACCTCTCCAAGGAGTCGCTGGCGGGGAACAAGCCGGCCAACGCCGTCCTGCACAAGGTTC
:::::::::::::::::::::::::::::::::::::::::::::::::::::::::.::::::::::::::::::::::::::::::::::::::   :
CGCTTCGCCGAGGCCGAGTGCCTGGCCGAGAGCCACCAGCACCTCTCCAAGGAGTCGTTGGCGGGGAACAAGCCGGCCAACGCCGTCCTGCACAAG---C
-R--F--A--E--A--E--C--L--A--E--S--H--Q--H--L--S--K--E--S--L--A--G--N--K--P--A--N--A--V--L--H--K-----

<---------------------------------------------------------------------------------------------------
L--N--Q--L--E--E--L--L--S--D--M--K--A--D--V--T--R--L--P--A--T--L--S--R--I--P--P--I--A--A--R--L--Q--M
TGAACCAGCTGGAGGAGTTGCTGAGCGACATGAAGGCGGACGTGACCCGCCTGCCAGCCACGCTGTCCCGAATACCCCCCATCGCAGCCCGCCTTCAGAT
::::::::::::::::::::::::::::::::::::::::::::::::::::: ::::::::::::::::::::::::::::::::::::::::::::::
TGAACCAGCTGGAGGAGTTGCTGAGCGACATGAAGGCGGACGTGACCCGCCTGGCAGCCACGCTGTCCCGAATACCCCCCATCGCAGCCCGCCTTCAGAT
L--N--Q--L--E--E--L--L--S--D--M--K--A--D--V--T--R--L--A--A--T--L--S--R--I--P--P--I--A--A--R--L--Q--M

---------------------------------------------------------------><-----------------------------------
--S--E--R--S--I--L--S--R--L--A--S--K--G--T--E--P--H--P--T--P--A--Y--P--P--G--P--Y--A--T--P--P--G--Y-
GTCCGAGCGCAGCATCCTCAGCCGGCTGGCCAGCAAGGGCACGGAGCCTCACCCCACACCGGCCTACCCGCCGGGTCCCTACGCTACACCTCCGGGGTAC
::::::::::::::::::::::::::::::::::::::::::::::::::.:::::::::::::: ::: ::::::::::::::.:::::::::::::::
GTCCGAGCGCAGCATCCTCAGCCGGCTGGCCAGCAAGGGCACGGAGCCTCGCCCCACACCGGCCTTCCCCCCGGGTCCCTACGCCACACCTCCGGGGTAC
--S--E--R--S--I--L--S--R--L--A--S--K--G--T--E--P--R--P--T--P--A--F--P--P--G--P--Y--A--T--P--P--G--Y-

------------------------------------------------------------------------------------------><--------
-G--A--A--F--S--A--A--P--V--G--A--L--A--A--A--G--A--N--Y--S--Q--M--P--A--G--S--F--I--T--A--A--T--N--
GGGGCGGCCTTCAGCGCCGCACCCGTAGGGGCCCTGGCCGCCGCAGGCGCCAATTACAGCCAGATGCCTGCAGGGTCCTTCATCACAGCCGCCACCAACG
::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::                
GGGGCGGCCTTCAGCGCCGCACCCGTAGGGGCCCTGGCCGCCGCAGGCGCCAATTACAGCCAGATGCCTGCAGGGTCCTTCATC----------------
-G--A--A--F--S--A--A--P--V--G--A--L--A--A--A--G--A--N--Y--S--Q--M--P--A--G--S--F--I-----------------

-----
G--P-
GCCCT
     
-----
-----

Pig Consensus Sequence

>BGISUST0000885315
----------------------------------------------------------------------------------------------------
--AAAGATGACATTCGGCTGCTGCCTTCAGCATTGGGTGTGAAGAAGAGAAAACGAGGACCCAAGAAGCAGAAGGAGAACAAGCCAGGGAAACCCCGAAA
ACGCAAGAAG---GACAGCGAGGAGGAATTTGGCTCTGAGCGAGATGAGTACCGGGAGAAGTCGGAGAGTGGAGGCAGTGAATATGGAACCGGACCCGGT
CGGAAACGGAGAAGGAAGCACCGAGAAAAAAAAAAAAAAAAA----------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
------------------------TATGTTTTGCAGAGCGACGAGGGCCCCGAACCCGAGGCTGAGGAGTCAGACCTGGACAGCGGCAGTGTCCACAGTG
CCTCAGGCCGGCCCGATGGCCCCGTCCGCACCAAGAAACTAAAGAGAGGCCGGCCAGGACGGAAGAAGAAGAAG---CTGGGCTGTCCCGCAGTGGCCGG
GGAGGAGGAGGTTGATGGCTACGAGACGGATCACCAGGATTACTGTGAGGTGTGCCAGCAGGGTGGGGAAATTATTCTGTGTGACACCTGCCCTCGTGCC
TACCACCTCGTCTGCCTTGATCCTGAGCTTGACCGGGCTCCTGAGGGCAAGTGGAGCTGCCCCCACTGTGAGAAGGAGGGCGTTCAGTGGGAGGCAAAGG
AGGAGGATGACGACTACGAAGAGGAGGGAGAGGAGGAAGGGGAGAAGGAGGAGGAGGACGACCACATGGAGTACTGCCGCGTGTGCAAGGACGGCGGCGA
GCTGCTGTGCTGCGATGCCTGCATCTCCTCCTACCACATCCACTGCCTGAACCCGCCCCTGCCCGACATCCCCAACGGTGAATGGCTGTGTCCCCGATGC
ACATGTCCTGTGCTGAAAGGCCGTGTGCAGAAGATCCTGCACTGGCGGTGGGGGGAGCCACCCGTGGCAGTGCCAGCCCCCCAACAGGCAGATGGGAATC
CGGATGCCCCACCCCCACGTCCCCTTCAAGGCAGGTCGGAGCGAGAGTTCTTTGTCAAGTGGGTAGGACTGTCCTACTGGCATTGCTCCTGGGCCAAGGA
GCTTCAGCTGGAGATCTTCCACTTGGTCATGTACCGGAACTACCAACGGAAGAACGACATGGATGAGCCCCCGCCCCTGGACTATGGCTCTGGGGAGGAT
GACGGGAAGAGTGACAAGCGCAAGGTGAAGGACCCGCACTACGCCGAGATGGAGGAGAAGTACTATCGCTTTGGCATCAAGCCCGAGTGGATGACCGTCC
ACCGGATCATCAACCAC---GTGGATAAAAAGGGGAATTACCACTATCTAGTGAAATGGAGGGACTTGCCCTATGACCAGTCCACATGGGAGGAAGATGA
AATGAACATCCCTGAATATGAAGACCACAAGCAAAGCTACTGGAGACAC---GAACTCATTATGGGGGAGGACCCCGCCCAGCCCCGCAAGTATAAGAAG
AAGAAGAAGGAACTGCAGGGCGACGGGCCTCCCAGTTCTCCCACTAACGATCCTACAGTGAAATACGAGACACAGCCCCGGTCTATCACAGCCACCGGAG
GCACGCTGCACGTGTATCAGCTGGAAGGGTTGAACTGGCTACGCTTCTCGTGGGCCCAGGGCACAGACACCATTCTGGCTGATGAGATGGGGCTGGGCAA
GACCGTACAAACCATCGTCTTCCTCTACTCTCTCTATAAGGAGGGCCACACGAAGGGTCCCTTTCTGGTGAGTGCTCCACTCTCTACCATCATTAACTGG
GAGCGGGAGTTCCAGATGTGGGCACCGAAgtATGTGGTGACATACACGGGTGACAAGGACAGCCGGGCCATCATTCGTGAGAATGAGTTTTCCTTTGAAG
ACAACGCCATCAAAGGTGGCAAGAAAGCTTTCAAGATGAAGAGGGAGGCCCAGGTGAAGTTCCACGTTCTCCTGACATCATATGAGCTGATCACCATTGA
TCAGGCAGCGCTTGGCTCCATCCGCTGGGCCTGTCTCGTGGTGGATGAAGCCCATCGGCTCAAGAACAACCAGTCCAAG---------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
--------------------------------------------------------------------------------------CTGCTGCAGAAGAT
GCTGCGGAAGCTCAAGGAGCAAGGACACAGAGTGCTCATCTTCTCGCAGATGACCAAAATGTTAGACTTGCTAGAGGACTTCCTCGACTACGAAGGCTAC
AAGTATGAGCGCATCGATGGTGGCATCACTGGCGCCCTGAGGCAGGAGGCCATCGACCGCTTTAAT---CCTGGGGCCCAGCAATTCTGCTTCCTCCTGT
CTACCCGAGCTGGAGGCCTGGGCATCAATCTCGCCACAGCAGACACTGTCATCATCTTTGATTCTGACTGGAACCCCCATAATGACATCCAGGCCTTCAG
CCGTGCTCATCGGATCGGCCAGGCCAACAAAGTGATGATTTACCGATTTGTGACTCGCGCATCAGTGGAAGAGCGGATCACACAGGTGGCCAAGCGAAAG
ATGATGCTGACACACCTGGTGGTGCGGCCCGGGCTGGGCTCCAAGGCAGGCTCCATGTCCAAGCAGGAGCTGGACGACATCCTCAAATTTGGCACTGAGG
AGCTATTTAAGGATGAAAATGAG-----------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
---------------------------------------CGTCAGCGGAAGGCCTTCCTCAACGCCGTGATGCGCTGGGGCATGCCGCCGCAGGACGCCT
TCACCACCCAGTGGCTGGTGCGCGACCTGAGGGGCAAGACGGAGAAGGAG------GCCTATGTGTCTTTGTTCATGCGCCATCTCTGTGAGCCCGGGGC
AGACGGCTCTGAAACCTTTGCGGACGGGGTCCCTCGGGAGGGACTGAGTCGCCAGCAAGTGTTGACCCGCATTGGAGTCATGTCACTCGTCAAGAAGAAG
GTTCAGGAGTTTGAGCACATCAACGGGCGCTGGTCTATGCCGGAGCTGATGCCTGACCCCAGCGCTGACTCCAAGCGCTCCTCCAGAGCCTCCTCTCCTA
CCAAGACCTCCCCCACCACTCCTGAGGCTTCTGCTGCCAACAGTCCTTGCACCTCAGAA------ACTCCAGCTCCAAGTGAGAAAGGAGAGGGCATGAG
GACACCTCTGGAGAAGGATGAAGCAGAAATCCAGGAGGAGAAGCCAGGGAAAAAAAAAAAA---------------------------------------
----------------------------------------------------------------------------------------------------
-----------------------GACGTGAAAGGGGACCGGGAGCTCCGACCTGGGCCTCCTCGAGACGAGCTGCGGTCCAATGGGCGACGCGAGGAGAA
GGTGGAGAAGCCGCGGTTCATGTTCAACATTGCAGACGGTGGCTTC---CTTCACACACTGTGGCAGAATGAGGAACGGGCAGCTATTTCCTCGGGGAAA
CTCAATGAGATCTGGCACCGAAGACATGACTATTGGCTTCTGGCTGGGATTGTC---CATGGCTACGCACGGTGGCAGGAcaTCCAGAACGATGCTCAGT
TTGCCATTATCAACGAGCCATTTAAAACTGAAGCTAATAAGGGGAACTTTCTGGAGATGAAAAATAAGTTCCTGGCCCGGAGATTCAAGCTCCTGGAGCA
GGCGCTGGTGATCGAGGAGCAGCTGCGGCGGGCGGCCTACCTGAACCTATCACAGGAGCCGGCGCACCCcgCCATGGCCCTCCACGCCCGCTTCGCCGAG
GCCGAGTGCCTGGCCGAGAGCCACCAGCACCTCTCCAAGGAGTCGTTGGCGGGGAACAAGCCGGCCAACGCCGTCCTGCACAAG---CTGAACCAGCTGG
AGGAGTTGCTGAGCGACATGAAGGCGGACGTGACCCGCCTGGCAGCCACGCTGTCCCGAATACCCCCCATCGCAGCCCGCCTTCAGATGTCCGAGCGCAG
CATCCTCAGCCGGCTGGCCAGCAAGGGCACGGAGCCTCGCCCCACACCGGCCTTCCCCCCGGGTCCCTACGCCACACCTCCGGGGTACGGGGCGGCCTTC
AGCGCCGCACCCGTAGGGGCCCTGGCCGCCGCAGGCGCCAATTACAGCCAGATGCCTGCAGGGTCCTTCATC---------------------


>BGISUSP0000885315
----------------------------------KDDIRLLPSALGVKKRKRGPKKQKENKPGKPRKRKK-DSEEEFGSERDEYREKSESGGSEYGTGPG
RKRRRKHREKKKKK--------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
--------YVLQSDEGPEPEAEESDLDSGSVHSASGRPDGPVRTKKLKRGRPGRKKKK-LGCPAVAGEEEVDGYETDHQDYCEVCQQGGEIILCDTCPRA
YHLVCLDPELDRAPEGKWSCPHCEKEGVQWEAKEEDDDYEEEGEEEGEKEEEDDHMEYCRVCKDGGELLCCDACISSYHIHCLNPPLPDIPNGEWLCPRC
TCPVLKGRVQKILHWRWGEPPVAVPAPQQADGNPDAPPPRPLQGRSEREFFVKWVGLSYWHCSWAKELQLEIFHLVMYRNYQRKNDMDEPPPLDYGSGED
DGKSDKRKVKDPHYAEMEEKYYRFGIKPEWMTVHRIINH-VDKKGNYHYLVKWRDLPYDQSTWEEDEMNIPEYEDHKQSYWRH-ELIMGEDPAQPRKYKK
KKKELQGDGPPSSPTNDPTVKYETQPRSITATGGTLHVYQLEGLNWLRFSWAQGTDTILADEMGLGKTVQTIVFLYSLYKEGHTKGPFLVSAPLSTIINW
EREFQMWAPKYVVTYTGDKDSRAIIRENEFSFEDNAIKGGKKAFKMKREAQVKFHVLLTSYELITIDQAALGSIRWACLVVDEAHRLKNNQSK-------
----------------------------------------------------------------------------------------------------
--------------------------------------------------------------LLQKMLRKLKEQGHRVLIFSQMTKMLDLLEDFLDYEGY
KYERIDGGITGALRQEAIDRFN-PGAQQFCFLLSTRAGGLGINLATADTVIIFDSDWNPHNDIQAFSRAHRIGQANKVMIYRFVTRASVEERITQVAKRK
MMLTHLVVRPGLGSKAGSMSKQELDDILKFGTEELFKDENE-----------------------------------------------------------
----------------------------------------------------------------------------------------------------
-------------RQRKAFLNAVMRWGMPPQDAFTTQWLVRDLRGKTEKE--AYVSLFMRHLCEPGADGSETFADGVPREGLSRQQVLTRIGVMSLVKKK
VQEFEHINGRWSMPELMPDPSADSKRSSRASSPTKTSPTTPEASAANSPCTSE--TPAPSEKGEGMRTPLEKDEAEIQEEKPGKKKK-------------
-----------------------------------------DVKGDRELRPGPPRDELRSNGRREEKVEKPRFMFNIADGGF-LHTLWQNEERAAISSGK
LNEIWHRRHDYWLLAGIV-HGYARWQDIQNDAQFAIINEPFKTEANKGNFLEMKNKFLARRFKLLEQALVIEEQLRRAAYLNLSQEPAHPAMALHARFAE
AECLAESHQHLSKESLAGNKPANAVLHK-LNQLEELLSDMKADVTRLAATLSRIPPIAARLQMSERSILSRLASKGTEPRPTPAFPPGPYATPPGYGAAF
SAAPVGALAAAGANYSQMPAGSFI-------