Sequences
EST Library Info
ecc2Foetus 50 days, cortex cerebri
Clusters
Oligos
SNPs

Gene ID ENSG00000198673 (click for geneview)
Transcript ID ENST00000358343(link to ensembl)
Symbol FAM19A2
Localtion Chromosome:12:60388322:60703829:-1 band: 12q14.1
Description family with sequence similarity 19 (chemokine (C-C motif)-like), member A2 [Source:RefSeq_peptide;Acc:NP_848634]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--S--K--R--Y--L--Q--K--A--T--K--G--K--L--L--I--I--I--F--I--V--T--L--W--G--K--V--V--S--S--A--N--H--
ATGAGTAAGAGATACTTACAGAAAGCAACAAAAGGAAAACTGCTAATAATAATATTTATTGTAACCTTGTGGGGGAAAGTTGTATCCAGTGCAAACCATC
::::::::::::::::::::::::::::::::::::::::::::::::::::: ::::::::::::::::::::::::::.::::::::::.::::::::
ATGAGTAAGAGATACTTACAGAAAGCAACAAAAGGAAAACTGCTAATAATAATCTTTATTGTAACCTTGTGGGGGAAAGTCGTATCCAGTGTAAACCATC
-M--S--K--R--Y--L--Q--K--A--T--K--G--K--L--L--I--I--I--F--I--V--T--L--W--G--K--V--V--S--S--V--N--H--

-----><---------------------------------------------------------------------------------------------
H--K--A--H--H--V--K--T--G--T--C--E-----V--V--A--L--H--R--C--C--N--K--N--K--I--E--E--R--S--Q--T--V--K
ATAAAGCTCACCATGTTAAAACGGGAACTTGTGAG---GTGGTGGCACTCCACAGATGCTGTAATAAGAACAAGATAGAAGAACGGTCACAAACAGTCAA
:::::   ::::::::::::::::: :::::::::   ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
ATAAA---CACCATGTTAAAACGGGCACTTGTGAGT--GTGGTGGCACTCCACAGATGCTGTAATAAGAACAAGATAGAAGAACGGTCACAAACAGTCAA
H--K-----H--H--V--K--T--G--T--C--E--\--V--V--A--L--H--R--C--C--N--K--N--K--I--E--E--R--S--Q--T--V--K

-------------------------------------------------------------><-------------------------------------
--C--S--C--F--P--G--Q--V--A--G--T--T--R--A--A--P--S--C--V--D--A--S--I--V--E--Q--K--W--W--C--H--M--Q-
GTGCTCCTGCTTCCCTGGGCAGGTGGCAGGCACCACGCGAGCTGCTCCATCATGTGTGGATGCTTCAATAGTGGAACAGAAATGGTGGTGCCATATGCAG
::::::::::::::::::::::::::::::::::::.::.::::::::::: :::::::::   :::::::::::::::::::::::::::::::::::.
GTGCTCCTGCTTCCCTGGGCAGGTGGCAGGCACCACACGGGCTGCTCCATCTTGTGTGGAT---TCAATAGTGGAACAGAAATGGTGGTGCCATATGCAA
--C--S--C--F--P--G--Q--V--A--G--T--T--R--A--A--P--S--C--V--D-----S--I--V--E--Q--K--W--W--C--H--M--Q-

--------------------------------------------------------------------------------------><---------->
-P--C--L--E--G--E--E--C--K--V--L--P--D--R--K--G--W--S--C--S--S--G--N--K--V--K--T--T--R--V--T--H--*-
CCATGTCTAGAGGGAGAAGAATGTAAAGTTCTTCCGGATCGGAAAGGATGGAGCTGTTCCTCTGGGAATAAAGTCAAAACAACTAGGGTAACCCATTAA
::.::::: ::::::::.:::::::::::::::::.:::::::::::::::::::::::::::::::::::::: ::::::::::::            
CCGTGTCTTGAGGGAGAGGAATGTAAAGTTCTTCCAGATCGGAAAGGATGGAGCTGTTCCTCTGGGAATAAAGTGAAAACAACTAGG------------
-P--C--L--E--G--E--E--C--K--V--L--P--D--R--K--G--W--S--C--S--S--G--N--K--V--K--T--T--R-------------

Pig Consensus Sequence

>BGISUST0000902248
ATGAGTAAGAGATACTTACAGAAAGCAACAAAAGGAAAACTGCTAATAATAATCTTTATTGTAACCTTGTGGGGGAAAGTCGTATCCAGTGTAAACCATC
ATAAA---CACCATGTTAAAACGGGCACTTGTGAggTGGTGGCACTCCACAGATGCTGTAATAAGAACAAGATAGAAGAACGGTCACAAACAGTCAAGTG
CTCCTGCTTCCCTGGGCAGGTGGCAGGCACCACACGGGCTGCTCCATCTTGTGTGGAT---TCAATAGTGGAACAGAAATGGTGGTGCCATATGCAACCG
TGTCTTGAGGGAGAGGAATGTAAAGTTCTTCCAGATCGGAAAGGATGGAGCTGTTCCTCTGGGAATAAAGTGAAAACAACTAGG------------


>BGISUSP0000902248
MSKRYLQKATKGKLLIIIFIVTLWGKVVSSVNHHK-HHVKTGTCEVVALHRCCNKNKIEERSQTVKCSCFPGQVAGTTRAAPSCVD-SIVEQKWWCHMQP
CLEGEECKVLPDRKGWSCSSGNKVKTTR----