Sequences
EST Library Info
plac4Unavailable
Clusters
Oligos
SNPs

Gene ID ENSG00000132549 (click for geneview)
Transcript ID ENST00000358544(link to ensembl)
Symbol COH1_HUMAN
Localtion Chromosome:8:100094670:100958983:1 band: 8q22.2
Description Cohen syndrome protein 1. [Source:Uniprot/SWISSPROT;Acc:Q7Z7G8]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--L--E--S--Y--V--T--P--I--L--M--S--Y--V--N--R--Y--I--K--N--L--K--P--S--D--L--Q--L--S--L--W--G--G--
ATGCTGGAGTCATATGTAACTCCAATTTTAATGAGCTATGTGAATCGCTACATCAAGAACTTAAAGCCGTCGGATCTACAGCTTTCACTATGGGGTGGAG
:::.:.:::::::::::.:::::::::::::::::::::::::::::::::::::::::::::::::::::.::::::::::::::::::::::::::::
ATGTTAGAGTCATATGTGACTCCAATTTTAATGAGCTATGTGAATCGCTACATCAAGAACTTAAAGCCGTCAGATCTACAGCTTTCACTATGGGGTGGAG
-M--L--E--S--Y--V--T--P--I--L--M--S--Y--V--N--R--Y--I--K--N--L--K--P--S--D--L--Q--L--S--L--W--G--G--

----------------------------------------------><----------------------------------------------------
D--V--V--L--S--K--L--E--L--K--L--D--V--L--E--Q--E--L--K--L--P--F--T--F--L--S--G--H--I--H--E--L--R--I
ACGTGGTACTCAGCAAGCTCGAGTTAAAGTTGGATGTGCTGGAACAGGAACTGAAATTACCATTCACTTTTTTAAGTGGACATATTCATGAATTGAGGAT
::::::: ::::::::::::::::::::.::::::::::::::.:::                                                     
ACGTGGTTCTCAGCAAGCTCGAGTTAAAATTGGATGTGCTGGAGCAG-----------------------------------------------------
D--V--V--L--S--K--L--E--L--K--L--D--V--L--E--Q------------------------------------------------------

------------------------------------------------------------------------------------------><--------
--H--V--P--W--T--K--L--G--S--E--P--V--V--I--T--I--N--T--M--E--C--I--L--K--L--K--D--G--I--Q--D--D--H-
TCATGTACCATGGACAAAACTGGGTTCAGAACCAGTGGTAATTACCATCAATACTATGGAATGCATTTTGAAACTTAAGGATGGGATACAGGATGACCAT
                                                                                           :::::::::
-------------------------------------------------------------------------------------------GATGACCAT
--------------------------------------------------------------------------------------------D--D--H-

----------------------------------------------------------------------------------------------------
-E--S--C--G--S--N--S--T--N--R--S--T--A--E--S--T--K--S--S--I--K--P--R--R--M--Q--Q--A--A--P--T--D--P--
GAAAGCTGTGGTTCTAATTCTACCAACCGTAGTACTGCTGAGAGCACAAAATCATCAATCAAACCGCGGAGAATGCAGCAGGCTGCTCCTACAGATCCTG
:::::.::::::::::::::::::::::::::::::.::::::.:::::::::::::.: :::::  :.::::: ::.:::::::::::..:::::::::
GAAAGTTGTGGTTCTAATTCTACCAACCGTAGTACTACTGAGAACACAAAATCATCAGTAAAACCCAGAAGAATTCAACAGGCTGCTCCCGCAGATCCTG
-E--S--C--G--S--N--S--T--N--R--S--T--T--E--N--T--K--S--S--V--K--P--R--R--I--Q--Q--A--A--P--A--D--P--

-----------><---------------------------------------------------------------------------------------
D--L--P--P--G--Y--V--Q--S--L--I--R--R--V--V--N--N--V--N--I--V--I--N--N--L--I--L--K--Y--V--E--D--D--I
ACTTACCACCAGGTTATGTGCAGAGTCTGATTAGACGAGTTGTAAATAATGTAAACATTGTGATAAATAATCTCATACTAAAATATGTTGAAGATGATAT
:.::.::::::   :::::::::::::::::::::::::::::::::::::::::.::::: ::::::::.::.:  :::::.::::: :::::::::::
ATTTGCCACCA---TATGTGCAGAGTCTGATTAGACGAGTTGTAAATAATGTAAATATTGTTATAAATAACCTTAGCCTAAAGTATGTGGAAGATGATAT
D--L--P--P-----Y--V--Q--S--L--I--R--R--V--V--N--N--V--N--I--V--I--N--N--L--S--L--K--Y--V--E--D--D--I

-------------------------------------------------------------------------------><-------------------
--V--L--S--V--N--I--T--S--A--E--C--Y--T--V--G--E--L--W--D--R--A--F--M--D--I--S--A--T--D--L--V--L--R-
CGTCCTTTCCGTCAATATCACTTCTGCAGAATGTTATACAGTAGGTGAATTATGGGATCGTGCATTCATGGATATTTCTGCAACTGATTTGGTGCTGAGA
.:::::::: :::::.:::::::::::::::::.:::::::::::::::::::::::::::::::::::::::::.:::   :::::. :::::::::::
TGTCCTTTCAGTCAACATCACTTCTGCAGAATGCTATACAGTAGGTGAATTATGGGATCGTGCATTCATGGATATCTCT---ACTGACGTGGTGCTGAGA
--V--L--S--V--N--I--T--S--A--E--C--Y--T--V--G--E--L--W--D--R--A--F--M--D--I--S-----T--D--V--V--L--R-

----------------------------------------------------------------------------------------------------
-K--V--I--N--F--S--D--C--T--V--C--L--D--K--R--N--A--S--G--K--I--E--F--Y--Q--D--P--L--L--Y--K--C--S--
AAGGTTATCAATTTTTCTGACTGTACAGTTTGTCTTGATAAACGGAATGCCAGTGGTAAAATAGAATTTTACCAGGATCCTTTATTATACAAATGTTCCT
::.:::::::::::::::::::::::::::::::::::::::::.:::::.::::::::::::::::::::::::::.::::::::.:::::::::::::
AAAGTTATCAATTTTTCTGACTGTACAGTTTGTCTTGATAAACGAAATGCTAGTGGTAAAATAGAATTTTACCAGGACCCTTTATTGTACAAATGTTCCT
-K--V--I--N--F--S--D--C--T--V--C--L--D--K--R--N--A--S--G--K--I--E--F--Y--Q--D--P--L--L--Y--K--C--S--

-------------------------------------------------------------><-------------------------------------
F--R--T--R--L--H--F--T--Y--E--N--L--N--S--K--M--P--S--V--I--K--I--H--T--L--V--E--S--L--K--L--S--I--T
TCAGAACTCGTCTTCATTTTACATATGAAAACCTAAATTCCAAGATGCCATCTGTTATTAAAATTCATACTTTAGTGGAAAGTTTGAAACTTTCTATCAC
:::::::: :::: :::::::::::::: ::::: :::::::::::::: ::::: ::::::                                      
TCAGAACTGGTCTGCATTTTACATATGATAACCTCAATTCCAAGATGCCTTCTGTAATTAAA--------------------------------------
F--R--T--G--L--H--F--T--Y--D--N--L--N--S--K--M--P--S--V--I--K---------------------------------------

----------------------------------------------------------------------------------------------------
--D--Q--Q--L--P--M--F--I--R--I--M--Q--L--G--I--A--L--Y--Y--G--E--I--G--N--F--K--E--G--E--I--E--D--L-
AGATCAACAACTGCCTATGTTTATTCGTATAATGCAACTTGGAATTGCTCTTTACTATGGAGAAATAGGCAATTTTAAAGAAGGCGAAATAGAGGACCTT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

------------------------------------><--------------------------------------------------------------
-T--C--H--N--K--D--M--L--G--N--I--T--G--S--E--D--E--T--R--I--D--M--Q--Y--P--A--Q--H--K--G--Q--E--L--
ACTTGTCATAATAAAGATATGCTAGGAAACATTACAGGTTCTGAAGATGAAACAAGAATAGATATGCAATATCCTGCTCAGCATAAAGGTCAAGAGTTAT
                                        :.::::::::::::::: ::::::::::.:::::: :::::.:.:::::.::::::::::
---------------------------------------GCCGAAGATGAAACAAGATTAGATATGCAGTATCCTTCTCAGTACAAAGGCCAAGAGTTAT
----------------------------------------A--E--D--E--T--R--L--D--M--Q--Y--P--S--Q--Y--K--G--Q--E--L--

----------------------------------------------------------------------------------------------------
Y--S--Q--Q--D--E--E--Q--P--Q--G--W--V--S--W--A--W--S--F--V--P--A--I--V--S--Y--D--D--G--E--E--D--F--V
ATTCACAGCAAGATGAGGAGCAGCCACAGGGATGGGTGTCATGGGCCTGGTCCTTTGTGCCTGCAATTGTGAGTTATGACGATGGCGAGGAAGACTTTGT
::::::::::::: :: ::.::::::::::: :::::::::::::::::::: ::::::::::::::::::::::::::.::::: :::::::::: . :
ATTCACAGCAAGAGGATGAACAGCCACAGGGTTGGGTGTCATGGGCCTGGTCATTTGTGCCTGCAATTGTGAGTTATGATGATGGAGAGGAAGACTACCT
Y--S--Q--Q--E--D--E--Q--P--Q--G--W--V--S--W--A--W--S--F--V--P--A--I--V--S--Y--D--D--G--E--E--D--Y--L

----------------------------------------------------------------------------------------------------
--G--N--D--P--A--S--T--M--H--Q--Q--K--A--Q--T--L--K--D--P--I--V--S--I--G--F--Y--C--T--K--A--T--V--T-
TGGGAACGATCCTGCATCAACCATGCATCAACAAAAAGCACAGACTTTGAAGGATCCTATTGTTTCTATAGGATTTTATTGCACAAAGGCAACGGTGACT
::::::.::::::.:::::: ::..::::::::.:::::::::::::::::::::::::::::::::::::::::::::::.:::::.: ::: ::::::
TGGGAATGATCCTACATCAAACACACATCAACAGAAAGCACAGACTTTGAAGGATCCTATTGTTTCTATAGGATTTTATTGTACAAAAGGAACTGTGACT
--G--N--D--P--T--S--N--T--H--Q--Q--K--A--Q--T--L--K--D--P--I--V--S--I--G--F--Y--C--T--K--G--T--V--T-

-----><---------------------------------------------------------------------------------------------
-F--K--L--T--E--M--Q--V--E--S--S--Y--Y--S--P--Q--K--V--K--S--K--E--V--L--C--W--E--Q--E--G--T--T--V--
TTCAAACTCACAGAAATGCAAGTTGAGAGTAGTTATTACAGTCCACAGAAAGTAAAATCTAAAGAAGTATTGTGTTGGGAACAAGAAGGAACTACAGTTG
::.:::                                                                                              
TTTAAA----------------------------------------------------------------------------------------------
-F--K-----------------------------------------------------------------------------------------------

-><-------------------------------------------------------------------------------------------------
E--A--L--M--M--G--E--P--F--F--D--C--Q--I--G--F--V--G--C--R--A--M--C--L--K--G--I--M--G--V--K--D--F--E
AGGCCCTTATGATGGGAGAACCTTTCTTTGATTGCCAGATTGGGTTTGTTGGTTGCAGAGCCATGTGCCTTAAAGGAATTATGGGTGTTAAAGATTTTGA
  :::::::::::::::::.:::::::::::::::::::: :: :: :: ::::::::::::::::::::::::::::::::::::::::::::::::::
--GCCCTTATGATGGGAGAGCCTTTCTTTGATTGCCAGAT-GGTTTAGTAGGTTGCAGAGCCATGTGCCTTAAAGGAATTATGGGTGTTAAAGATTTTGA
---A--L--M--M--G--E--P--F--F--D--C--Q--I--G--L--V--G--C--R--A--M--C--L--K--G--I--M--G--V--K--D--F--E

---------------------------><-----------------------------------------------------------------------
--E--N--M--N--R--S--E--T--E--A--C--F--F--I--C--G--D--N--L--S--T--K--G--F--T--Y--L--T--N--S--L--F--D-
AGAGAATATGAATAGAAGTGAAACTGAAGCCTGTTTCTTCATTTGTGGTGACAATTTGAGTACGAAAGGTTTCACATACCTTACAAATTCATTGTTTGAT
::::::::::::::::::::::::::::::::::::::::::.:::::::: :::::.::::..:::::::: ::::::::.:::::::::         
AGAGAATATGAATAGAAGTGAAACTGAAGCCTGTTTCTTCATCTGTGGTGAAAATTTAAGTATAAAAGGTTTGACATACCTCACAAATTCA---------
--E--N--M--N--R--S--E--T--E--A--C--F--F--I--C--G--E--N--L--S--I--K--G--L--T--Y--L--T--N--S----------

-----------------------------------------------------------------><---------------------------------
-Y--R--S--P--E--N--N--G--T--R--A--E--F--I--L--D--S--T--H--H--K--E--T--Y--T--E--I--A--G--M--Q--R--F--
TACCGAAGCCCAGAAAATAATGGTACTCGCGCAGAATTTATCTTGGATTCAACTCATCATAAGGAGACATACACTGAGATAGCTGGAATGCAACGGTTTG
                                                               :::::::::::::::::::::::::::::: ::::::
---------------------------------------------------------------GAGACATACACTGAGATAGCTGGAATGCAAAGGTTTG
----------------------------------------------------------------E--T--Y--T--E--I--A--G--M--Q--R--F--

-----------------------------------------------------><---------------------------------------------
G--A--F--Y--M--D--Y--L--Y--T--M--E--N--T--S--G--K--G--S--T--N--Q--Q--D--F--S--S--G--K--S--E--D--L--G
GGGCTTTTTATATGGATTACCTGTATACAATGGAGAACACTAGTGGCAAAGGTTCCACAAATCAACAAGACTTTTCTTCAGGGAAAAGTGAAGATTTGGG
::::::::::.:::::::::::.::::::::::::::.::.:.:::::::   ::..: :::::.::::::::::::::.::::.:::::::::::::::
GGGCTTTTTACATGGATTACCTATATACAATGGAGAATACCAATGGCAAA---TCTGCCAATCAGCAAGACTTTTCTTCGGGGAGAAGTGAAGATTTGGG
G--A--F--Y--M--D--Y--L--Y--T--M--E--N--T--N--G--K-----S--A--N--Q--Q--D--F--S--S--G--R--S--E--D--L--G

----------------------------------------------------------------------------------------------------
--T--V--Q--E--K--S--T--K--S--L--V--I--G--P--L--D--F--R--L--D--S--S--A--V--H--R--I--L--K--M--I--V--C-
AACAGTTCAGGAGAAGTCCACCAAAAGCCTTGTTATAGGTCCTCTTGATTTTCGTTTGGATAGCAGTGCGGTGCATAGGATTTTGAAAATGATTGTGTGT
::: :::::.::.:::::.:::::::::::::::::::: ::::::::::::::.::::::::::::::.::.:::::.:::::.::::::::::: :::
AACTGTTCAAGAAAAGTCTACCAAAAGCCTTGTTATAGGACCTCTTGATTTTCGCTTGGATAGCAGTGCAGTACATAGAATTTTAAAAATGATTGTTTGT
--T--V--Q--E--K--S--T--K--S--L--V--I--G--P--L--D--F--R--L--D--S--S--A--V--H--R--I--L--K--M--I--V--C-

---------------------------------------------><-----------------------------------------------------
-A--L--E--H--E--Y--E--P--Y--S--R--L--K--S--D--I--K--D--E--N--E--T--I--L--N--P--E--E--V--A--L--L--E--
GCCTTGGAACATGAATATGAACCATATAGCAGGCTAAAATCAGATATTAAGGATGAAAATGAAACAATACTGAATCCTGAAGAGGTGGCTCTTCTGGAGG
 ::::::::::::::::::::::::::::.::.::::::      :.:::::::::::.:::::::.: ::.:::::::::::.::::: ..:.::::::
TCCTTGGAACATGAATATGAACCATATAGTAGACTAAAA------ACTAAGGATGAAAGTGAAACAGTTCTAAATCCTGAAGAAGTGGCATCTTTGGAGG
-S--L--E--H--E--Y--E--P--Y--S--R--L--K--------T--K--D--E--S--E--T--V--L--N--P--E--E--V--A--S--L--E--

----------------------------------------------------------------------------------------------------
E--Y--I--P--T--R--H--T--S--V--T--L--L--K--C--T--C--T--I--S--M--A--E--F--N--L--L--D--H--L--L--P--V--I
AATATATTCCTACTCGACATACAAGTGTTACTCTCCTCAAATGTACCTGCACAATTTCCATGGCTGAATTCAACTTGCTGGACCATTTACTACCTGTCAT
:::::::::::::::::::::::::::::::::::::::::::::::: ::::::::.::::::::::::::::::::::::.:::::.:::::::::::
AATATATTCCTACTCGACATACAAGTGTTACTCTCCTCAAATGTACCTTCACAATTTTCATGGCTGAATTCAACTTGCTGGATCATTTGCTACCTGTCAT
E--Y--I--P--T--R--H--T--S--V--T--L--L--K--C--T--F--T--I--F--M--A--E--F--N--L--L--D--H--L--L--P--V--I

---------------><-----------------------------------------------------------------------------------
--M--G--E--K--N--S--S--N--F--M--N--T--T--N--F--Q--S--L--R--P--L--P--S--I--R--I--L--V--D--K--I--N--L-
TATGGGAGAAAAGAACTCAAGTAACTTCATGAATACTACAAACTTCCAGTCTCTTCGGCCTTTGCCATCCATTCGAATATTGGTGGATAAAATTAATCTG
:::::::::::::                                                                                       
TATGGGAGAAAAG---------------------------------------------------------------------------------------
--M--G--E--K----------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-E--H--S--V--P--M--Y--A--E--Q--L--V--H--V--V--S--S--L--T--Q--P--S--D--N--L--L--H--Y--C--Y--V--H--C--
GAACATTCAGTGCCAATGTATGCTGAACAGTTGGTGCATGTGGTCAGCAGCCTTACTCAACCTTCTGATAACCTGCTTCATTATTGTTATGTACACTGCT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------><----------------------------------------------------------------------------------------
Y--L--K--I--F--G--F--Q--A--G--L--T--S--L--D--C--S--G--S--Y--C--L--P--V--P--V--I--P--S--F--S--T--A--L
ATCTTAAGATATTTGGTTTCCAGGCAGGACTGACGTCTTTGGATTGCAGTGGATCTTACTGCTTACCTGTACCAGTTATTCCCTCTTTCAGCACTGCTCT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-----------------------------------><---------------------------------------------------------------
--Y--G--K--L--L--K--L--P--T--C--W--T--K--R--S--Q--I--A--I--T--E--G--I--F--E--L--P--N--L--T--I--Q--A-
TTATGGGAAACTTCTGAAACTCCCCACATGCTGGACCAAAAGATCTCAGATTGCTATAACTGAAGGTATATTTGAACTTCCAAATCTCACAATTCAAGCT
                                     ::.::::::::::::::.:::::::::::::: ::::::::::::::::::::::::::::::
-------------------------------------AAGAGATCTCAGATTGCCATAACTGAAGGTATTTTTGAACTTCCAAATCTCACAATTCAAGCT
--------------------------------------K--R--S--Q--I--A--I--T--E--G--I--F--E--L--P--N--L--T--I--Q--A-

----------------------------------------------------------------------------------------------------
-T--R--A--Q--T--L--L--L--Q--A--I--Y--Q--S--W--S--H--L--G--N--V--S--S--S--A--V--I--E--A--L--I--N--E--
ACAAGAGCACAGACACTTCTCTTGCAAGCAATATATCAAAGTTGGTCTCATCTTGGAAATGTCAGCTCTTCCGCAGTGATTGAAGCTTTGATAAATGAAA
::::::::::::::::::.: .: ::::::::::::::::::::::::::: .:::::::::::::::::. ::::::: ::::::::::::.::::::.
ACAAGAGCACAGACACTTTTGCTTCAAGCAATATATCAAAGTTGGTCTCATACTGGAAATGTCAGCTCTTTAGCAGTGAATGAAGCTTTGATGAATGAAG
-T--R--A--Q--T--L--L--L--Q--A--I--Y--Q--S--W--S--H--T--G--N--V--S--S--L--A--V--N--E--A--L--M--N--E--

-----------------><---------------------------------------------------------------------------------
I--F--L--S--I--G--V--K--S--K--N--P--L--P--T--L--E--G--S--I--Q--N--V--E--L--K--Y--C--S--T--S--L--V--K
TCTTCCTAAGTATAGGTGTGAAATCTAAGAATCCCCTGCCAACTCTTGAGGGCTCAATCCAGAATGTTGAATTGAAGTACTGCAGCACATCATTGGTCAA
:.:::: :::::::   ::::::::::::::::::.::::::::::::::::::: ::::::::::::::::::::::::::::::::::: ::::::::
TTTTCCAAAGTATA---GTGAAATCTAAGAATCCCTTGCCAACTCTTGAGGGCTCTATCCAGAATGTTGAATTGAAGTACTGCAGCACATCCTTGGTCAA
V--F--Q--S--I-----V--K--S--K--N--P--L--P--T--L--E--G--S--I--Q--N--V--E--L--K--Y--C--S--T--S--L--V--K

----------------------------------------------------><----------------------------------------------
--C--A--S--G--T--M--G--S--I--K--I--C--A--K--A--P--V--D--S--G--K--E--K--L--I--P--L--L--Q--G--P--S--D-
ATGTGCCTCTGGGACCATGGGATCAATAAAAATTTGTGCCAAAGCCCCAGTTGATAGTGGAAAAGAGAAGTTGATTCCCTTGCTTCAGGGTCCTTCTGAC
:::.:::::::::::::::::::::::::::::::::::::::::::::                                                   
ATGCGCCTCTGGGACCATGGGATCAATAAAAATTTGTGCCAAAGCCCCA---------------------------------------------------
--C--A--S--G--T--M--G--S--I--K--I--C--A--K--A--P----------------------------------------------------

----------------------------------------------------------------------------------------------------
-T--K--D--L--H--S--T--K--W--L--N--E--S--R--K--P--E--S--L--L--A--P--D--L--M--A--F--T--I--Q--V--P--Q--
ACTAAAGACCTTCATAGCACCAAGTGGCTCAATGAGAGTAGAAAGCCAGAGTCTCTCTTAGCTCCAGATTTGATGGCCTTCACAATCCAAGTTCCACAAT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

--------------------------><------------------------------------------------------------------------
Y--I--D--Y--C--H--N--S--G--A--V--L--L--C--S--I--Q--G--L--A--V--N--I--D--P--I--L--Y--T--W--L--I--Y--Q
ATATTGACTACTGCCACAATTCCGGTGCTGTACTTCTTTGCAGTATACAAGGACTAGCAGTTAATATTGACCCAATCTTATATACGTGGCTCATCTATCA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

------------------------------------><--------------------------------------------------------------
--P--Q--K--R--T--S--R--H--M--Q--Q--Q--P--V--V--A--V--P--L--V--M--P--V--C--R--R--K--E--D--E--V--S--I-
GCCTCAGAAACGAACAAGTAGACATATGCAACAGCAGCCTGTGGTAGCTGTTCCTCTTGTTATGCCAGTTTGTAGAAGGAAAGAGGATGAGGTGTCTATT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

---------------------------------------------------------------------------------------><-----------
-G--S--A--P--L--A--K--Q--Q--S--Y--Q--A--S--E--Y--A--S--S--P--V--K--T--K--T--V--T--E--S--R--P--L--S--
GGAAGTGCCCCCTTGGCAAAGCAGCAATCATATCAGGCCTCTGAATATGCCAGCAGCCCTGTAAAAACAAAAACGGTAACAGAATCCCGCCCATTGTCAG
:::::::: ::::::::::::::.:: :::::::::::::::::::::::::::::.:::.:::::::::::::.::::::   ::: : ::::::::::
GGAAGTGCGCCCTTGGCAAAGCAACA-TCATATCAGGCCTCTGAATATGCCAGCAGTCCTATAAAAACAAAAACAGTAACA---TCCAGACCATTGTCAG
-G--S--A--P--L--A--K--Q--Q--S--Y--Q--A--S--E--Y--A--S--S--P--I--K--T--K--T--V--T-----S--R--P--L--S--

----------------------------------------------------------------------------------------------------
V--P--V--K--A--M--L--N--I--S--E--S--C--R--S--P--E--E--R--M--K--E--F--I--G--I--V--W--N--A--V--K--H--L
TTCCTGTTAAAGCCATGTTGAATATATCTGAAAGCTGTAGAAGTCCTGAAGAAAGAATGAAGGAATTTATTGGAATTGTTTGGAATGCAGTGAAGCATCT
:::::.: :::::::::.::::::::::::::.::::::::::.:::::::::::::::::.::::::::::::.: :: :::::::::::.::: .:::
TTCCTATGAAAGCCATGCTGAATATATCTGAAGGCTGTAGAAGCCCTGAAGAAAGAATGAAAGAATTTATTGGAGTAGTATGGAATGCAGTAAAGAGTCT
V--P--M--K--A--M--L--N--I--S--E--G--C--R--S--P--E--E--R--M--K--E--F--I--G--V--V--W--N--A--V--K--S--L

---------------><-----------------------------------------------------------------------------------
--T--L--Q--L--E--V--Q--S--C--C--V--F--I--P--N--D--S--L--P--S--P--S--T--I--V--S--G--D--I--P--G--T--V-
CACACTACAGCTTGAAGTACAATCTTGTTGTGTGTTTATTCCAAATGATAGCCTGCCTTCCCCAAGTACAATTGTATCTGGTGACATTCCTGGAACAGTA
:::::::::::::::::::::::::::.::::::::.::.::::::::::::.::::::::::.:::::::::::::::::::::::::::::::::::.
CACACTACAGCTTGAAGTACAATCTTGCTGTGTGTTCATCCCAAATGATAGCTTGCCTTCCCCGAGTACAATTGTATCTGGTGACATTCCTGGAACAGTG
--T--L--Q--L--E--V--Q--S--C--C--V--F--I--P--N--D--S--L--P--S--P--S--T--I--V--S--G--D--I--P--G--T--V-

----------------------------------------------------------------------------------------------------
-R--S--W--Y--H--G--Q--T--S--M--P--G--T--L--V--L--C--L--P--Q--I--K--I--I--S--A--G--H--K--Y--M--E--P--
AGAAGTTGGTACCATGGACAAACCAGCATGCCGGGAACACTTGTCCTCTGTTTGCCTCAAATAAAGATTATTAGTGCTGGGCACAAGTATATGGAACCTC
:::::::::::::::::::::::::::::::: ::.:..::::::::::::::::::::::: ::::::.:::::::::: ::::::::.::::::::::
AGAAGTTGGTACCATGGACAAACCAGCATGCCTGGGATGCTTGTCCTCTGTTTGCCTCAAATCAAGATTGTTAGTGCTGGCCACAAGTACATGGAACCTC
-R--S--W--Y--H--G--Q--T--S--M--P--G--M--L--V--L--C--L--P--Q--I--K--I--V--S--A--G--H--K--Y--M--E--P--

--------------------------------------------------><------------------------------------------------
L--Q--E--I--P--F--V--I--P--R--P--I--L--E--E--G--D--A--F--P--W--T--I--S--L--H--N--F--S--I--Y--T--L--L
TGCAGGAGATTCCATTTGTTATCCCACGACCCATCCTTGAAGAAGGTGATGCTTTTCCTTGGACGATCAGCTTGCATAATTTCAGCATATATACCCTTCT
:::::::::::::::::::.::::::::::::::::::::::::   ::::::::::::::::: :::::::::::: ::::::::::::::::::::.:
TGCAGGAGATTCCATTTGTCATCCCACGACCCATCCTTGAAGAA---GATGCTTTTCCTTGGACCATCAGCTTGCATCATTTCAGCATATATACCCTTTT
L--Q--E--I--P--F--V--I--P--R--P--I--L--E--E-----D--A--F--P--W--T--I--S--L--H--H--F--S--I--Y--T--L--F

----------------------------------------------------------------------------------------------------
--G--K--Q--V--T--L--C--L--V--E--P--M--G--C--T--S--T--L--A--V--T--S--Q--K--L--L--A--T--G--P--D--T--R-
TGGAAAACAAGTGACACTTTGCCTAGTGGAACCTATGGGTTGCACCTCCACTCTAGCTGTCACGTCTCAAAAACTGCTTGCTACGGGACCTGATACACGA
::::::::::::.:::::::::::::::::::::::::::::.:::::.:::::::::::.::.:: :::::::::::..::.:.:::::::::::. :.
TGGAAAACAAGTAACACTTTGCCTAGTGGAACCTATGGGTTGTACCTCTACTCTAGCTGTTACATCGCAAAAACTGCTCACTGCAGGACCTGATACGAGG
--G--K--Q--V--T--L--C--L--V--E--P--M--G--C--T--S--T--L--A--V--T--S--Q--K--L--L--T--A--G--P--D--T--R-

-----------------------------------------------------------------------><---------------------------
-H--S--F--V--V--C--L--H--V--D--L--E--S--L--E--I--K--C--S--N--P--Q--V--Q--L--F--Y--E--L--T--D--I--M--
CATTCATTTGTTGTCTGTCTCCATGTTGACCTAGAGTCACTAGAGATAAAATGCTCTAATCCCCAGGTCCAGCTCTTCTATGAACTAACTGATATCATGA
:::::::::::::::::::: ::.::::::::::::::::: ::.::::::::::: ::.::::::                                  
CATTCATTTGTTGTCTGTCTGCACGTTGACCTAGAGTCACTTGAAATAAAATGCTCGAACCCCCAG----------------------------------
-H--S--F--V--V--C--L--H--V--D--L--E--S--L--E--I--K--C--S--N--P--Q-----------------------------------

----------------------------------------------------------------------------------------------------
N--K--V--W--N--K--I--Q--K--R--G--N--L--N--L--S--P--T--S--P--E--T--M--A--G--P--V--P--T--S--P--V--R--S
ATAAGGTCTGGAACAAGATTCAGAAGAGAGGCAATCTCAACCTATCTCCAACCTCTCCAGAGACCATGGCAGGGCCTGTTCCTACTTCTCCAGTTAGAAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

---------------------------------------------------------------------------><-----------------------
--S--I--G--T--A--P--P--D--T--S--T--C--S--P--S--A--D--I--G--T--T--T--E--G--D--S--I--Q--A--G--E--E--S-
CAGTATAGGCACAGCTCCTCCAGATACCAGCACATGCAGCCCATCTGCTGACATTGGGACTACTACTGAGGGAGATTCTATACAAGCAGGTGAGGAATCA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-P--F--S--D--S--V--T--L--E--Q--T--T--S--N--I--G--G--T--S--G--R--V--S--L--W--M--Q--W--V--L--P--K--I--
CCATTCTCAGATTCTGTGACCTTGGAACAAACTACAAGTAATATTGGAGGAACCAGTGGACGTGTTAGTTTATGGATGCAGTGGGTGCTTCCCAAAATTA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-----------------------------------------------><---------------------------------------------------
T--I--K--L--F--A--P--D--P--E--N--K--G--T--E--V--C--M--V--S--E--L--E--D--L--S--A--S--I--D--V--Q--D--V
CTATAAAGCTCTTTGCTCCAGATCCTGAAAATAAAGGCACAGAGGTTTGTATGGTCAGTGAACTAGAAGATCTCAGTGCTTCCATAGATGTCCAGGATGT
                                                           :::::::::::::::::::::::::::::::::::::::::
-----------------------------------------------------------GAACTAGAAGATCTCAGTGCTTCCATAGATGTCCAGGATGT
------------------------------------------------------------E--L--E--D--L--S--A--S--I--D--V--Q--D--V

-----------------------------------------------------------------><---------------------------------
--Y--T--K--V--K--C--K--I--E--S--F--N--I--D--H--Y--R--S--S--L--G--E--E--C--W--S--L--G--Q--C--G--G--V-
ATATACCAAAGTGAAATGTAAAATAGAGAGTTTCAATATTGATCACTATAGAAGCAGCCTTGGGGAAGAGTGTTGGTCTTTGGGGCAATGTGGAGGTGTC
.::.:::::::::::::::::::::::.::::::::::: ::.:::::.::::::   :::::::::::::::::::::.::::::::::::::::::::
GTACACCAAAGTGAAATGTAAAATAGAAAGTTTCAATAT-GACCACTACAGAAGC---CTTGGGGAAGAGTGTTGGTCTCTGGGGCAATGTGGAGGTGTC
--Y--T--K--V--K--C--K--I--E--S--F--N--I--D--H--Y--R--S-----L--G--E--E--C--W--S--L--G--Q--C--G--G--V-

----------------------------------------------------------------------------------------------------
-F--L--S--C--T--D--K--L--N--R--R--T--L--L--V--R--P--I--S--K--Q--D--P--F--S--N--C--S--G--F--F--P--S--
TTCCTTTCCTGTACTGACAAGCTGAACAGACGCACCTTGTTGGTTCGACCCATCAGCAAGCAGGACCCTTTCAGTAATTGCTCTGGCTTCTTTCCTTCTA
:::::.:::::::::::::::::::::::::::::::::::::::::::::::::::::::: :::::::::                            
TTCCTCTCCTGTACTGACAAGCTGAACAGACGCACCTTGTTGGTTCGACCCATCAGCAAGCA-GACCCTTTC----------------------------
-F--L--S--C--T--D--K--L--N--R--R--T--L--L--V--R--P--I--S--K--Q--D--P--F-----------------------------

----------><----------------------------------------------------------------------------------------
T--T--T--K--L--L--D--G--T--H--Q--Q--H--G--F--L--S--L--T--Y--T--K--A--V--T--K--N--V--R--H--K--L--T--S
CAACTACAAAACTTCTAGATGGCACTCATCAGCAGCATGGATTCCTCTCTCTGACATACACAAAAGCTGTAACAAAAAATGTCCGCCACAAGTTAACATC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--R--N--E--R--R--S--F--H--K--L--S--E--G--L--M--D--G--S--P--H--F--L--H--E--I--L--L--S--A--Q--A--F--D-
AAGAAATGAGCGAAGAAGTTTTCATAAGTTATCTGAAGGCCTAATGGATGGTTCTCCTCATTTTCTTCATGAAATTCTTCTTTCAGCACAAGCTTTTGAT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-I--V--L--Y--F--P--L--L--N--A--I--A--S--I--F--Q--A--K--L--P--K--T--Q--K--E--K--R--K--S--P--G--Q--P--
ATTGTTCTTTATTTTCCTTTACTTAATGCCATTGCAAGTATATTTCAAGCAAAACTACCAAAGACCCAAAAAGAGAAAAGAAAATCTCCTGGTCAGCCCA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
M--R--T--H--T--L--T--S--R--N--L--P--L--I--Y--V--N--T--S--V--I--R--I--F--I--P--K--T--E--E--M--Q--P--T
TGAGGACCCATACACTGACATCCCGCAATTTACCTTTGATTTATGTCAACACAAGTGTAATCAGAATTTTTATTCCAAAAACAGAAGAAATGCAGCCAAC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-------------------><-------------------------------------------------------------------------------
--V--E--A--N--Q--A--A--K--E--D--T--V--V--L--K--I--G--S--V--A--M--A--P--Q--A--D--N--P--L--G--R--S--V-
TGTTGAAGCTAATCAGGCAGCAAAAGAAGACACTGTGGTTTTGAAGATTGGCTCTGTTGCCATGGCTCCCCAGGCTGACAATCCCCTTGGCAGATCTGTC
             :::::::::::.::::::::..:::::.:::::::::::::::::::.::::::::::::::::::::::::::::::::::: :::
-------------CAGGCAGCAAAGGAAGACACCATGGTTCTGAAGATTGGCTCTGTTGCTATGGCTCCCCAGGCTGACAATCCCCTTGGCAGATCGGTC
--------------Q--A--A--K--E--D--T--M--V--L--K--I--G--S--V--A--M--A--P--Q--A--D--N--P--L--G--R--S--V-

-------------------------------><-------------------------------------------------------------------
-L--R--K--D--I--Y--Q--R--A--L--N--L--G--I--L--R--D--P--G--S--E--I--E--D--R--Q--Y--Q--I--D--L--Q--S--
CTTAGGAAAGATATTTACCAGAGAGCCTTGAACTTAGGAATTCTTCGAGATCCTGGATCAGAAATCGAAGACAGACAATACCAAATAGATCTGCAGTCCA
::.:::::::::::::::                                                                              ::::
CTCAGGAAAGATATTTAC------------------------------------------------------------------------------TCCA
-L--R--K--D--I--Y--------------------------------------------------------------------------------S--

----------------------------------------------------------------------------------------------------
I--N--I--G--T--A--Q--W--H--Q--L--K--P--E--K--E--S--V--S--G--G--V--V--T--E--T--E--R--N-----S--Q--N--P
TCAATATTGGTACTGCACAGTGGCATCAACTAAAACCAGAGAAGGAAAGTGTCTCAGGAGGGGTGGTAACAGAGACTGAAAGGAAT---TCTCAAAATCC
::::::::::::::::::::::: :::::::::::::::::::::::::::   ::::::::::: ::::::::: ::::::.:::    ::::.:::::
TCAATATTGGTACTGCACAGTGGGATCAACTAAAACCAGAGAAGGAAAGTGGAACAGGAGGGGTGCTAACAGAGAATGAAAGAAATT--GCTCAGAATCC
I--N--I--G--T--A--Q--W--D--Q--L--K--P--E--K--E--S--G--T--G--G--V--L--T--E--N--E--R--N--\--S--Q--N--P

--------------------------------------><------------------------------------------------------------
--A--L--E--W--N--M--A--S--S--I--R--R--H--Q--E--R--R--A--I--L--T--P--V--L--T--D--F--S--V--R--I--T--G-
AGCCCTTGAGTGGAATATGGCCAGCAGCATACGGCGGCATCAAGAAAGGAGAGCAATTTTGACCCCCGTTTTGACAGATTTTTCTGTCCGAATAACTGGA
:::::::::::::::::::::::::   :::::.::::::::::::::.::::::::::::::.:::.::::.:::::::::::::::::::::::::::
AGCCCTTGAGTGGAATATGGCCAGC---ATACGACGGCATCAAGAAAGAAGAGCAATTTTGACTCCCATTTTAACAGATTTTTCTGTCCGAATAACTGGA
--A--L--E--W--N--M--A--S-----I--R--R--H--Q--E--R--R--A--I--L--T--P--I--L--T--D--F--S--V--R--I--T--G-

-----------------------------------------------------------------><---------------------------------
-A--P--A--V--I--F--T--K--V--V--S--P--E--N--L--H--T--E--E--I--L--V--C--G--H--S--L--E--V--N--I--T--T--
GCACCTGCTGTCATTTTCACCAAAGTAGTTTCTCCAGAAAATTTGCATACTGAGGAGATTTTAGTGTGTGGCCATTCCTTAGAAGTGAATATAACCACAA
::::::::..::::::::::::::.::.:::::::::::::: ::::.::::::::::::::::::::::::::::::: .:::::::::::::::::::
GCACCTGCCATCATTTTCACCAAAATAATTTCTCCAGAAAATATGCACACTGAGGAGATTTTAGTGTGTGGCCATTCCTGGGAAGTGAATATAACCACAA
-A--P--A--I--I--F--T--K--I--I--S--P--E--N--M--H--T--E--E--I--L--V--C--G--H--S--W--E--V--N--I--T--T--

----------------------------------------------------------------------------------------------------
N--L--D--F--F--L--S--V--A--Q--V--Q--L--L--H--Q--L--I--V--A--N--M--T--G--L--E--P--S--N--K--A--A--E--I
ACCTGGACTTCTTCCTAAGTGTGGCTCAAGTTCAACTCTTACATCAGTTAATAGTAGCAAATATGACTGGACTGGAACCATCAAACAAGGCTGCAGAGAT
::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: ::::::::.:::.::..:::::  
ACCTGGACTTCTTCCTAAGTGTGGCTCAAGTTCAACTCTTACATCAGTTAATAGTAGCAAATATGACTGGACTGGCACCATCAAGCAAAGCCACAGAG--
N--L--D--F--F--L--S--V--A--Q--V--Q--L--L--H--Q--L--I--V--A--N--M--T--G--L--A--P--S--S--K--A--T--E---

---------><-----------------------------------------------------------------------------------------
--S--K--Q--E--Q--K--K--V--D--I--F--D--G--G--M--A--E--T--S--S--R--Y--S--G--A--Q--D--S--G--I--G--S--D-
CTCTAAACAAGAACAGAAAAAAGTGGATATATTTGATGGAGGCATGGCTGAAACCTCATCTCGCTACAGTGGTGCTCAGGATAGTGGAATTGGCAGTGAC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-S--V--K--I--R--I--V--Q--I--E--Q--H--S--G--A--S--Q--H--R--I--A--R--P--S--R--Q--S--S--I--V--K--N--L--
AGTGTTAAAATCAGAATAGTGCAAATAGAGCAGCACAGTGGTGCCAGTCAGCATCGCATTGCCCGTCCCTCACGCCAGTCATCAATTGTAAAAAATCTAA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
N--F--I--P--F--D--I--F--I--T--A--S--R--I--S--L--M--T--Y--S--C--M--A--L--S--K--S--K--S--Q--E--Q--K--N
ATTTTATTCCCTTTGACATATTTATTACTGCAAGTAGAATCTCACTAATGACCTATTCCTGTATGGCCTTATCCAAATCGAAATCACAAGAACAGAAGAA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--N--E--K--T--D--K--S--S--L--N--L--P--E--V--D--S--D--V--A--K--P--N--Q--A--C--I--S--T--V--T--A--E--D-
TAATGAAAAAACAGACAAGAGTTCATTAAATCTCCCAGAAGTTGATTCAGATGTTGCTAAGCCCAACCAGGCATGTATTTCCACGGTGACAGCAGAAGAT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-L--L--R--S--S--I--S--F--P--S--G--K--K--I--G--V--L--S--L--E--S--L--H--A--S--T--R--S--S--A--R--Q--A--
CTCTTAAGGAGCAGCATTTCTTTTCCTTCAGGGAAAAAAATAGGGGTCCTCTCTCTTGAAAGTCTTCATGCATCCACAAGGTCATCTGCTAGACAAGCAC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
L--G--I--T--I--V--R--Q--P--G--R--R--G--T--G--D--L--Q--L--E--P--F--L--Y--F--I--V--S--Q--P--S--L--L--L
TTGGTATAACTATTGTTCGGCAGCCTGGTCGAAGAGGAACTGGTGACTTACAGCTAGAGCCTTTTCTGTACTTTATTGTGTCCCAGCCTTCCTTGCTTCT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-------------------------------------------------------------------------------------------------><-
--S--C--H--H--R--K--Q--R--V--E--V--S--I--F--D--A--V--L--K--G--V--A--S--D--Y--K--C--I--D--P--G--K--T-
GAGTTGTCACCACAGAAAGCAGCGAGTGGAAGTATCCATTTTTGATGCTGTGCTTAAAGGGGTGGCCTCTGATTACAAATGTATAGATCCTGGGAAGACT
    ::.:::::::::::::::::::::::::::::::::::::::::::::::::::::.::.::::::::::::::::::      ::::::::::::
----TGCCACCACAGAAAGCAGCGAGTGGAAGTATCCATTTTTGATGCTGTGCTTAAAGGAGTAGCCTCTGATTACAAATGT------CCTGGGAAGACT
-----C--H--H--R--K--Q--R--V--E--V--S--I--F--D--A--V--L--K--G--V--A--S--D--Y--K--C--------P--G--K--T-

----------------------------------------------------------------------------------------------------
-L--P--E--A--L--D--Y--C--T--V--W--L--Q--T--V--P--G--E--I--D--S--K--S--G--I--P--P--S--F--I--T--L--Q--
CTGCCTGAAGCCCTTGATTATTGCACTGTTTGGCTACAGACAGTGCCTGGAGAAATAGACAGCAAAAGTGGTATTCCACCTTCCTTTATAACACTACAGA
::::::::::::::::::::.::::: ::::::::.::::::::::::::::::::::::::::::::::::::::::::::::.::.:.:: ::.::.:
CTGCCTGAAGCCCTTGATTACTGCACAGTTTGGCTGCAGACAGTGCCTGGAGAAATAGACAGCAAAAGTGGTATTCCACCTTCCCTTGTGACCCTGCAAA
-L--P--E--A--L--D--Y--C--T--V--W--L--Q--T--V--P--G--E--I--D--S--K--S--G--I--P--P--S--L--V--T--L--Q--

-----------------------------------><---------------------------------------------------------------
I--K--D--F--L--N--G--P--A--D--V--N--L--D--I--S--K--P--L--K--A--N--L--S--F--T--K--L--D--Q--I--N--L--F
TTAAAGACTTTCTGAATGGACCAGCGGATGTCAATTTGGATATATCAAAGCCTTTGAAAGCAAACCTGAGTTTCACCAAACTGGATCAGATAAACCTTTT
::::::::::.:: :::::::::   ::..:: :.:::::::::::::::::::::::::::::: :::::::.:::::.:::::::::::::::  .::
TTAAAGACTTCCTTAATGGACCA---GACATCCACTTGGATATATCAAAGCCTTTGAAAGCAAACGTGAGTTTTACCAAGCTGGATCAGATAAACAACTT
I--K--D--F--L--N--G--P-----D--I--H--L--D--I--S--K--P--L--K--A--N--V--S--F--T--K--L--D--Q--I--N--N--F

----------------------------------------------------------------------------------------------------
--L--K--K--I--K--N--A--H--S--L--A--H--S--E--E--T--S--A--M--S--N--T--M--V--N--K--D--D--L--P--V--S--K-
TTTAAAGAAGATAAAAAATGCACACAGTTTGGCACATAGTGAAGAGACTTCAGCCATGTCCAACACCATGGTGAATAAGGATGATCTTCCAGTCTCCAAA
::::::::::::: :::.:::::::                                                                           
TTTAAAGAAGATACAAAGTGCACAC---------------------------------------------------------------------------
--L--K--K--I--Q--S--A--H----------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-Y--Y--R--G--K--L--S--K--P--K--I--H--G--D--G--V--Q--K--I--S--A--Q--E--N--M--W--R--A--V--S--C--F--Q--
TATTACCGTGGAAAGTTGTCTAAACCCAAAATTCATGGTGATGGAGTGCAAAAGATTTCAGCTCAAGAAAACATGTGGAGAGCTGTTTCCTGCTTTCAAA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
K--I--S--V--Q--T--T--Q--I--V--I--S--M--E--T--V--P--H--T--S--K--P--C--L--L--A--S--L--S--N--L--N--G--S
AAATTTCTGTTCAAACTACTCAGATTGTGATCTCCATGGAAACTGTACCCCATACCAGCAAACCATGCCTGTTAGCATCTCTCTCAAACCTCAATGGAAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-------------------------------------------><-------------------------------------------------------
--L--S--V--K--A--T--Q--K--V--P--G--I--I--L--G--S--S--F--L--L--S--I--N--D--F--L--L--K--T--S--L--K--E-
CCTTAGTGTCAAGGCAACACAAAAAGTACCTGGCATAATTCTTGGGTCATCATTTCTACTCAGTATAAACGATTTTCTCCTTAAAACAAGTCTCAAAGAA
                                  .: ::::::::.::::::::: :::::::..::::.::::::::::::::::::::::::::::::
----------------------------------GTCATTCTTGGATCATCATTTGTACTCAGCGTAAATGATTTTCTCCTTAAAACAAGTCTCAAAGAA
-----------------------------------V--I--L--G--S--S--F--V--L--S--V--N--D--F--L--L--K--T--S--L--K--E-

----------------------------------------------------------------------------------------------------
-R--S--R--I--L--I--G--P--C--C--A--T--A--N--L--E--A--K--W--C--K--H--S--G--N--P--G--P--E--Q--S--I--P--
AGAAGCCGCATTCTGATAGGACCATGTTGTGCTACTGCCAATCTGGAAGCTAAGTGGTGTAAACACAGCGGGAATCCAGGCCCAGAACAATCCATACCAA
:::::.:: .::::::::::::::::.::::::::::::::.:::::::::::.:::::::::::.::.:: ::.::::::::::::::.::::::::::
AGAAGTCGGGTTCTGATAGGACCATGCTGTGCTACTGCCAACCTGGAAGCTAAATGGTGTAAACATAGTGGCAACCCAGGCCCAGAACAGTCCATACCAA
-R--S--R--V--L--I--G--P--C--C--A--T--A--N--L--E--A--K--W--C--K--H--S--G--N--P--G--P--E--Q--S--I--P--

----------------------------------------------><----------------------------------------------------
K--I--S--I--D--L--R--G--G--L--L--Q--V--F--W--G--Q--E--H--L--N--C--L--V--L--L--H--E--L--L--N--G--Y--L
AAATATCCATTGACTTAAGAGGAGGTCTACTACAGGTCTTCTGGGGTCAAGAACATTTGAATTGTTTAGTTCTTCTACATGAATTACTCAATGGATACCT
:::::::::::::.::::::::::::::.:: :::::.::::::::::::::::::::::::::.::.::::::::::::::::::::::::::::::::
AAATATCCATTGATTTAAGAGGAGGTCTGCTCCAGGTTTTCTGGGGTCAAGAACATTTGAATTGCTTGGTTCTTCTACATGAATTACTCAATGGATACCT
K--I--S--I--D--L--R--G--G--L--L--Q--V--F--W--G--Q--E--H--L--N--C--L--V--L--L--H--E--L--L--N--G--Y--L

----------------------------------------------------------------------------------------------------
--N--E--E--G--N--F--E--V--Q--V--S--E--P--V--P--Q--M--S--S--P--V--E--K--N--Q--T--F--K--S--E--Q--S--S-
TAATGAGGAGGGAAATTTTGAAGTACAAGTTTCTGAACCAGTGCCTCAAATGTCATCTCCTGTGGAAAAGAATCAGACATTTAAAAGTGAACAAAGTTCA
:::::::::::::. :::::: ::.::::.::::::: ::::.:: ::::::.::::::::. .:::::::::::::..::::::.::::::::::::::
TAATGAGGAGGGAGCTTTTGACGTGCAAGCTTCTGAAGCAGTACCACAAATGCCATCTCCTAAAGAAAAGAATCAGATGTTTAAAGGTGAACAAAGTTCA
--N--E--E--G--A--F--D--V--Q--A--S--E--A--V--P--Q--M--P--S--P--K--E--K--N--Q--M--F--K--G--E--Q--S--S-

------------------------------------------------------><--------------------------------------------
-D--D--L--R--T--G--L--F--Q--Y--V--Q--D--A--E--S--L--K--L--P--G--V--Y--E--V--L--F--Y--N--E--T--E--D--
GATGACCTACGGACAGGTCTATTTCAGTATGTACAGGATGCTGAATCTTTGAAATTGCCTGGGGTCTATGAAGTCTTATTTTATAATGAAACTGAAGATT
::::::::::::::::::                                                                                  
GATGACCTACGGACAGGT----------------------------------------------------------------------------------
-D--D--L--R--T--G-----------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
C--P--G--M--M--L--W--R--Y--P--E--P--R--V--L--T--L--V--R--I--T--P--V--P--F--N--T--T--E--D--P--D--I--S
GCCCAGGGATGATGTTATGGAGATATCCAGAACCTAGAGTACTCACCCTTGTACGAATAACTCCTGTACCTTTTAACACCACAGAGGATCCAGATATTAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

---------------------------------------><-----------------------------------------------------------
--T--A--D--L--G--D--V--L--Q--V--P--C--S--L--E--Y--W--D--E--L--Q--K--V--F--V--A--F--R--E--F--N--L--S-
CACAGCAGACCTTGGTGATGTGCTACAGGTTCCTTGTAGCTTGGAATACTGGGATGAACTCCAGAAGGTTTTTGTTGCATTTAGAGAATTTAATCTGTCT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-E--S--K--V--C--E--L--Q--L--P--D--I--N--L--V--N--D--Q--K--K--L--V--S--S--D--L--W--R--I--V--L--N--S--
GAAAGCAAAGTTTGTGAACTGCAGTTGCCGGATATCAATCTCGTGAATGACCAGAAGAAATTAGTATCTTCAGATCTTTGGAGAATTGTCTTGAACAGCA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

------------------------------------><--------------------------------------------------------------
S--Q--N--G--A--D--D--Q--S--S--A--S--E--S--G--S--Q--S--T--C--D--P--L--V--T--P--T--A--L--A--A--C--T--R
GTCAAAATGGAGCTGATGACCAAAGCTCTGCAAGTGAGTCTGGTTCTCAAAGCACTTGTGATCCACTTGTGACTCCAACAGCCCTGGCTGCCTGTACCAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--V--D--S--C--F--T--P--W--F--V--P--S--L--C--V--S--F--Q--F--A--H--L--E--F--H--L--C--H--H--L--D--Q--L-
AGTTGACTCCTGCTTTACCCCATGGTTTGTCCCATCCCTTTGCGTTTCTTTCCAGTTTGCTCACCTGGAATTCCATCTTTGTCATCACCTTGACCAACTA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

------------------><--------------------------------------------------------------------------------
-G--T--A--A--P--Q--Y--L--Q--P--F--V--S--D--R--N--M--P--S--E--L--E--Y--M--I--V--S--F--R--E--P--H--M--
GGCACAGCTGCACCACAGTACCTACAGCCATTTGTTTCCGACAGAAATATGCCATCTGAACTAGAATACATGATTGTTTCCTTCAGAGAACCACACATGT
          ::::.::.:::::::::::::::::::::::.:.:::..::::: :::::::::::::.::::::.::::::::::::::::::::::.:
---------CCACCGCAATACCTACAGCCATTTGTTTCCGATAAAAACGTGCCAACTGAACTAGAATATATGATTATTTCCTTCAGAGAACCACACATAT
----------P--P--Q--Y--L--Q--P--F--V--S--D--K--N--V--P--T--E--L--E--Y--M--I--I--S--F--R--E--P--H--I--

----------------------------------------------------------------------------------------------------
Y--L--R--Q--W--N--N--G--S--V--C--Q--E--I--Q--F--L--A--Q--A--D--C--K--L--L--E--C--R--N--V--T--M--Q--S
ATCTTCGACAGTGGAATAATGGTTCTGTCTGTCAGGAGATCCAGTTCTTAGCTCAAGCAGACTGTAAACTTCTAGAGTGCAGAAATGTCACTATGCAAAG
:::: :::::.:::::.:::.:::::::::::::::::::::::::::.:::::: :: ::::::::::::.:.:::::::::::.::.:: ::::::::
ATCTGCGACAATGGAACAATAGTTCTGTCTGTCAGGAGATCCAGTTCTCAGCTCACGCTGACTGTAAACTTTTGGAGTGCAGAAACGTTACGATGCAAAG
Y--L--R--Q--W--N--N--S--S--V--C--Q--E--I--Q--F--S--A--H--A--D--C--K--L--L--E--C--R--N--V--T--M--Q--S

----------------------------------------------------------------------------------------------------
--V--V--K--P--F--S--I--F--G--Q--M--A--V--S--S--D--V--V--E--K--L--L--D--C--T--V--I--V--D--S--V--F--V-
TGTGGTGAAACCCTTCAGCATCTTCGGGCAGATGGCAGTTTCCAGCGATGTAGTGGAAAAGCTGCTTGACTGCACCGTGATAGTTGATTCTGTATTTGTA
. :::::::.::::::::::::::.::.:::.: ::::::::::::...:.::..::::::::: :.::::::.::.: .: .::::.::::::::::::
CCTGGTGAAGCCCTTCAGCATCTTTGGACAGGTTGCAGTTTCCAGCAGCGCAGCAGAAAAGCTGATCGACTGCGCCATCGTCATTGACTCTGTATTTGTA
--L--V--K--P--F--S--I--F--G--Q--V--A--V--S--S--S--A--A--E--K--L--I--D--C--A--I--V--I--D--S--V--F--V-

--------------------------------------------------------------------><------------------------------
-N--L--G--Q--H--V--V--H--S--L--N--T--A--I--Q--A--W--Q--Q--N--K--C--P--E--V--E--E--L--V--F--S--H--F--
AACCTTGGACAGCATGTAGTCCATTCACTAAACACTGCAATACAAGCTTGGCAACAGAACAAATGCCCTGAGGTAGAGGAGTTGGTCTTCAGCCATTTTG
:::.:.::.::.::::::::.::.:: ::::::::::::.:::::::::::::::::                                           
AACTTCGGGCAACATGTAGTTCACTCTCTAAACACTGCAGTACAAGCTTGGCAACAG-------------------------------------------
-N--F--G--Q--H--V--V--H--S--L--N--T--A--V--Q--A--W--Q--Q--------------------------------------------

----------------------------------------------------------------------------------------------------
V--I--C--N--D--T--Q--E--T--L--R--F--G--Q--V--D--T--D--E--N--I--L--L--A--S--L--H--S--H--Q--Y--S--W--R
TGATCTGTAATGACACACAGGAGACACTGCGGTTTGGCCAGGTGGATACTGATGAAAATATTCTGCTGGCGAGTCTCCACAGTCACCAGTACAGCTGGCG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

------------------------------><--------------------------------------------------------------------
--S--H--K--S--P--Q--L--L--H--I--C--I--E--G--W--G--N--W--R--W--S--E--P--F--S--V--D--H--A--G--T--F--I-
CTCTCACAAATCCCCACAGCTGTTACACATCTGTATTGAAGGTTGGGGCAACTGGCGTTGGTCAGAGCCTTTCAGTGTGGACCATGCCGGGACTTTTATT
                   ::::::::::::::::::::::::::::::::.::::..:::::.:::::.::::::::::::::.::.:: :::::::::
-------------------CTGTTACACATCTGTATTGAAGGTTGGGGCAATTGGCACTGGTCGGAGCCCTTCAGTGTGGACCACGCTGGTACTTTTATT
--------------------L--L--H--I--C--I--E--G--W--G--N--W--H--W--S--E--P--F--S--V--D--H--A--G--T--F--I-

--------------------------------------------------------------------------------------><------------
-R--T--I--Q--Y--R--G--R--T--A--S--L--I--I--K--V--Q--Q--L--N--G--V--Q--K--Q--I--I--I--C--G--R--Q--I--
AGAACAATTCAGTACAGGGGTCGAACTGCTTCTCTCATCATCAAGGTTCAGCAACTCAATGGAGTACAAAAACAGATTATCATCTGTGGAAGACAGATCA
::::: ::::::::::.:: :::::::::::: ::::::::::::.:::::::::::: .:::::.:::::::::                         
AGAACTATTCAGTACAAGGCTCGAACTGCTTCGCTCATCATCAAGATTCAGCAACTCACCGGAGTGCAAAAACAG-------------------------
-R--T--I--Q--Y--K--A--R--T--A--S--L--I--I--K--I--Q--Q--L--T--G--V--Q--K--Q--------------------------

----------------------------------------------------------------------------------------------------
I--C--S--Y--L--S--Q--S--I--E--L--K--V--V--Q--H--Y--I--G--Q--D--G--Q--A--V--V--R--E--H--F--D--C--L--T
TCTGTAGTTACTTGTCTCAAAGCATAGAACTAAAAGTCGTTCAGCATTACATTGGTCAAGATGGACAAGCTGTAGTTCGGGAACATTTTGACTGCCTCAC
                                                                                                  ::
--------------------------------------------------------------------------------------------------AC
---------------------------------------------------------------------------------------------------T

----------------------------------------------------------------------------------------------------
--A--K--Q--K--L--P--S--Y--I--L--E--N--N--E--L--T--E--L--C--V--K--A--K--G--D--E--D--W--S--R--D--V--C-
AGCCAAACAGAAATTGCCTTCGTACATACTAGAAAACAATGAACTGACGGAGCTGTGTGTGAAGGCCAAAGGAGATGAAGACTGGTCAAGAGATGTGTGC
::::::.::::::::::::::.:::::::: :::::::.::::::::: :::.:::::::::.::::::::::::::::.:::::::.:::::.::::::
AGCCAAGCAGAAATTGCCTTCATACATACTCGAAAACAGTGAACTGACCGAGTTGTGTGTGAGGGCCAAAGGAGATGAAAACTGGTCGAGAGACGTGTGC
--A--K--Q--K--L--P--S--Y--I--L--E--N--S--E--L--T--E--L--C--V--R--A--K--G--D--E--N--W--S--R--D--V--C-

--------------------------------------------------><------------------------------------------------
-L--E--S--K--A--P--E--Y--S--I--V--I--Q--V--P--S--S--N--S--S--I--I--Y--V--W--C--T--V--L--T--L--E--P--
CTGGAATCCAAAGCCCCTGAGTACAGCATTGTCATTCAGGTGCCATCTTCAAACAGTTCCATTATTTATGTCTGGTGCACAGTTTTGACTTTAGAACCCA
:::.:::::::.:::::::::::.:::                                                                         
CTGAAATCCAAGGCCCCTGAGTATAGC-------------------------------------------------------------------------
-L--K--S--K--A--P--E--Y--S--------------------------------------------------------------------------

----------------------------------><----------------------------------------------------------------
N--S--Q--V--Q--Q--R--M--I--V--F--S--P--L--F--I--M--R--S--H--L--P--D--P--I--I--I--H--L--E--K--R--S--L
ACTCTCAAGTGCAACAACGAATGATTGTGTTCAGCCCTCTTTTTATCATGAGGAGTCATCTTCCAGACCCCATTATCATACATTTGGAGAAAAGGAGTCT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--G--L--S--E--T--Q--I--I--P--G--K--G--Q--E--K--P--L--Q--N--I--E--P--D--L--V--H--H--L--T--F--Q--A--R-
GGGATTGAGTGAAACACAAATTATTCCAGGAAAAGGGCAGGAAAAACCACTGCAAAACATAGAACCTGACCTTGTACATCACCTGACATTCCAAGCAAGA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------><----------------------------------------------------------------------------------------
-E--E--Y--D--P--S--D--C--A--V--P--I--S--T--S--L--I--K--Q--I--A--T--K--V--H--P--G--G--T--V--N--Q--I--
GAAGAATATGATCCTTCAGATTGTGCAGTTCCCATCTCAACATCCCTCATTAAGCAAATAGCCACTAAGGTACACCCTGGAGGCACAGTTAATCAGATCC
:::::: ::::::: ::: ::::::: ::.:::::::::::::::::::::::::::::::::::::::.::::::: ::::: ::::::::::::::::
GAAGAAGATGATCCATCACATTGTGCCGTCCCCATCTCAACATCCCTCATTAAGCAAATAGCCACTAAGATACACCCAGGAGGGACAGTTAATCAGATCC
-E--E--D--D--P--S--H--C--A--V--P--I--S--T--S--L--I--K--Q--I--A--T--K--I--H--P--G--G--T--V--N--Q--I--

---------------------------------------------------------------------------------><-----------------
L--D--E--F--Y--G--P--E--K--S--L--Q--P--I--W--P--Y--N--K--K--D--S--D--R--N--E--Q--L--S--Q--W--D--S--P
TTGACGAATTCTATGGGCCAGAAAAGTCGCTTCAACCCATATGGCCCTATAATAAGAAGGATTCTGACAGGAATGAACAGCTAAGTCAGTGGGATAGCCC
:.:::::::::::::::::::::::::: ::::::::::..::::::::::::::.::::::::::::                                
TCGACGAATTCTATGGGCCAGAAAAGTCCCTTCAACCCACGTGGCCCTATAATAAAAAGGATTCTGAC--------------------------------
L--D--E--F--Y--G--P--E--K--S--L--Q--P--T--W--P--Y--N--K--K--D--S--D---------------------------------

----------------------------------------------------------------------------------------------------
--M--R--V--K--L--S--I--W--K--P--Y--V--R--T--L--L--I--E--L--L--P--W--A--L--L--I--N--E--S--K--W--D--L-
AATGCGAGTGAAGCTGTCAATCTGGAAGCCATATGTTAGAACTTTGTTGATAGAACTTCTGCCCTGGGCCCTGCTTATCAATGAATCCAAATGGGACCTC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-----------------------------------------------------------------------------------><---------------
-W--L--F--E--G--E--K--I--V--L--Q--V--P--A--G--K--I--I--I--P--P--N--F--Q--E--A--F--Q--I--G--I--Y--W--
TGGCTATTTGAAGGAGAGAAAATTGTTCTACAGGTTCCTGCTGGCAAAATTATTATTCCTCCTAATTTTCAGGAAGCTTTTCAAATTGGAATATACTGGG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
A--N--T--N--T--V--H--K--S--V--A--I--K--L--V--H--N--L--T--S--P--K--W--K--D--G--G--N--G--E--V--V--T--L
CAAATACAAACACTGTGCACAAGTCAGTAGCAATTAAACTGGTCCATAACCTGACATCTCCAAAGTGGAAAGATGGAGGTAATGGTGAAGTTGTGACACT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

------------------------------------------------------------------------><--------------------------
--D--E--E--A--F--V--D--T--E--I--R--L--G--A--F--P--G--H--Q--K--L--C--Q--F--C--I--S--S--M--V--Q--Q--G-
GGATGAAGAAGCGTTTGTTGATACTGAAATAAGACTTGGTGCTTTTCCAGGACATCAGAAGTTATGTCAGTTCTGCATTTCCTCCATGGTACAGCAAGGT
                                                             :::::.:::::::::::::::::::::::: . :::::.
-------------------------------------------------------------TTATGCCAGTTCTGCATTTCCTCCATGGTAAG-CAAGGC
--------------------------------------------------------------L--C--Q--F--C--I--S--S--M--V--Q--Q--G-

----------------------------------------------------------------------------------------------------
-I--Q--I--I--Q--I--E--D--K--T--T--I--I--N--N--T--P--Y--Q--I--F--Y--K--P--Q--L--S--V--C--N--P--H--S--
ATACAAATTATTCAGATTGAAGACAAGACTACAATAATCAATAATACACCATATCAAATATTTTATAAACCACAGCTATCTGTCTGCAATCCCCATTCTG
::::::.:::::::::::::::::::::::::::::::::::::::: ::::::::.:::::::::::::: :::.:.::::::: ::  ::::: ::::
ATACAAGTTATTCAGATTGAAGACAAGACTACAATAATCAATAATACCCCATATCAGATATTTTATAAACCCCAGTTGTCTGTCTCCACACCCCAGTCTG
-I--Q--V--I--Q--I--E--D--K--T--T--I--I--N--N--T--P--Y--Q--I--F--Y--K--P--Q--L--S--V--S--T--P--Q--S--

----------------------><----------------------------------------------------------------------------
G--K--E--Y--F--R--V--P--D--S--A--T--F--S--I--C--P--G--G--E--Q--P--A--M--K--S--S--S--L--P--C--W--D--L
GAAAGGAGTATTTTCGTGTTCCAGACAGTGCTACTTTTAGCATTTGCCCAGGTGGAGAGCAGCCTGCTATGAAATCCAGCTCCCTTCCTTGCTGGGACTT
:::::::::::::::...::::.:::.::::::::::.::: ::..::: ::::: ::::::::::: .::: .:.::::::::::::::::::::::::
GAAAGGAGTATTTTCACATTCCGGACGGTGCTACTTTCAGCCTTCACCCTGGTGGCGAGCAGCCTGCAGTGACGTTCAGCTCCCTTCCTTGCTGGGACTT
G--K--E--Y--F--H--I--P--D--G--A--T--F--S--L--H--P--G--G--E--Q--P--A--V--T--F--S--S--L--P--C--W--D--L

----------------------------------------------------------------------------------------------------
--M--P--D--I--S--Q--S--V--L--D--A--S--L--L--Q--K--Q--I--M--L--G--F--S--P--A--P--G--A--D--S--S--Q--C-
GATGCCTGACATCAGTCAGTCAGTACTGGATGCATCCCTGCTTCAGAAACAGATCATGCTGGGCTTTTCTCCTGCCCCAGGTGCTGACAGCTCACAGTGC
.: ::::::::::::::::::::. :::::::::::::::::::::::::::::: :::::: :::: :::::::: :::  ::..::::::: ::::.:
AAGGCCTGACATCAGTCAGTCAGCCCTGGATGCATCCCTGCTTCAGAAACAGATCTTGCTGGCCTTTGCTCCTGCCGCAGCAGCCAACAGCTCCCAGTAC
--R--P--D--I--S--Q--S--A--L--D--A--S--L--L--Q--K--Q--I--L--L--A--F--A--P--A--A--A--A--N--S--S--Q--Y-

----------------------------------------------------------------------------------------------------
-W--S--L--P--A--I--V--R--P--E--F--P--R--Q--S--V--A--V--P--L--G--N--F--R--E--N--G--F--C--T--R--A--I--
TGGAGCCTGCCAGCTATAGTTAGACCAGAGTTTCCCAGACAGAGTGTGGCAGTACCCCTCGGGAATTTCCGGGAAAATGGATTCTGTACCAGGGCTATAG
::::::::: : ::..::::::::: ::::::.::::::::.:::::::::::.:::.: ::::..: . :::::::::::::::::             
TGGAGCCTGNCCGCCGTAGTTAGACAAGAGTTCCCCAGACAAAGTGTGGCAGTGCCCTTGGGGAGCTGTGGGGAAAATGGATTCTGT-------------
-W--S--L--X--A--V--V--R--Q--E--F--P--R--Q--S--V--A--V--P--L--G--S--C--G--E--N--G--F--C--------------

------><--------------------------------------------------------------------------------------------
V--L--T--Y--Q--E--H--L--G--V--T--Y--L--T--L--S--E--D--P--S--P--R--V--I--I--H--N--R--C--P--V--K--M--L
TGCTGACATATCAAGAACACCTCGGAGTGACTTATTTAACCCTCTCAGAAGACCCTAGTCCTCGAGTAATTATCCACAATAGATGTCCAGTAAAAATGCT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------><----------------------------------------------------------------
--I--K--E--N--I--K--D--I--P--K--F--E--V--Y--C--K--K--I--P--S--E--C--S--I--H--H--E--L--Y--H--Q--I--S-
TATAAAGGAAAACATTAAAGATATTCCAAAGTTTGAGGTTTATTGCAAAAAAATTCCCTCCGAGTGCTCAATTCATCATGAGCTGTATCATCAGATTTCC
                         ::::::::::::::::::::::.::::::.::..::::::::::..::::::::::::::::::::::::: :::
-------------------------CCAAAGTTTGAGGTTTATTGCAGAAAAATCCCTCCCGAGTGCTCGGTTCATCATGAGCTGTATCATCAGATGTCC
--------------------------P--K--F--E--V--Y--C--R--K--I--P--P--E--C--S--V--H--H--E--L--Y--H--Q--M--S-

----------------------------------------------------------------------------------------------------
-S--Y--P--D--C--K--T--K--D--L--L--P--S--L--L--L--R--V--E--P--L--D--E--V--T--T--E--W--S--D--A--I--D--
AGTTATCCGGACTGCAAGACCAAAGACTTACTTCCAAGCCTACTTTTGAGAGTTGAACCTCTAGATGAAGTAACAACTGAGTGGAGTGATGCCATTGACA
::::::::.:::::::::::::.:::::::::::::::::: ::.:::::::: :::.. ::.:: :: .:.:: :::::.::::::::::::::.::::
AGTTATCCAGACTGCAAGACCAGAGACTTACTTCCAAGCCTCCTCTTGAGAGTAGAATTGCTGGAGGATATGACCACTGAATGGAGTGATGCCATCGACA
-S--Y--P--D--C--K--T--R--D--L--L--P--S--L--L--L--R--V--E--L--L--E--D--M--T--T--E--W--S--D--A--I--D--

----------------------------------><----------------------------------------------------------------
I--N--S--Q--G--T--Q--V--V--F--L--T--G--F--G--Y--V--Y--V--D--V--V--H--Q--C--G--T--V--F--I--T--V--A--P
TCAACAGTCAGGGAACACAGGTTGTGTTCCTGACTGGCTTTGGCTATGTGTATGTGGATGTTGTACATCAGTGTGGCACAGTCTTCATCACTGTGGCCCC
::::::.::::::::: ::::::::::::::::::::::::::::.:::.::.:::::...::: :::::: ::::::: .:::::::::::::::::::
TCAACAATCAGGGAACCCAGGTTGTGTTCCTGACTGGCTTTGGCTGTGTATACGTGGACACTGTCCATCAGGGTGGCACCATCTTCATCACTGTGGCCCC
I--N--N--Q--G--T--Q--V--V--F--L--T--G--F--G--C--V--Y--V--D--T--V--H--Q--G--G--T--I--F--I--T--V--A--P

-----------------------------------------------------><---------------------------------------------
--E--G--K--A--G--P--I--L--T--N--T--N--R--A--P--E--K--I--V--T--F--K--M--F--I--T--Q--L--S--L--A--V--F-
AGAAGGAAAAGCAGGACCTATTTTAACCAATACCAACAGAGCGCCAGAGAAGATTGTTACATTTAAAATGTTCATCACTCAGTTAAGCCTGGCAGTGTTT
:::::::::::: :::::.::::::::.::.::: ::                                                               
AGAAGGAAAAGCTGGACCCATTTTAACTAACACCCAC---------------------------------------------------------------
--E--G--K--A--G--P--I--L--T--N--T--H----------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-D--D--L--T--H--H--K--A--S--A--E--L--L--R--L--T--L--D--N--I--F--L--C--V--A--P--G--A--G--P--L--P--G--
GATGACCTCACCCACCACAAAGCATCAGCTGAGCTTCTGAGACTCACACTGGACAACATTTTTCTCTGTGTGGCCCCGGGAGCTGGTCCCCTCCCTGGGG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
E--E--P--V--A--A--L--F--E--L--Y--C--V--E--I--C--C--G--D--L--Q-----L--D--N--Q--L--Y--N--K--S--N--F--H
AAGAGCCTGTGGCTGCGTTGTTTGAACTTTACTGTGTGGAGATCTGCTGTGGGGACCTGCAG---CTAGACAACCAGCTTTATAACAAGTCCAATTTCCA
                                      :::.:::::::.::::::::::::   ::.::::::::::: ::.:::::::::::::::::
--------------------------------------GAGGTCTGCTGCGGGGACCTGCAGC--CTGGACAACCAGCTGTACAACAAGTCCAATTTCCA
---------------------------------------E--V--C--C--G--D--L--Q--\--L--D--N--Q--L--Y--N--K--S--N--F--H

----------------------------------------------------------------------------------------------------
--F--A--V--L--V--C--Q--G--E--K--A--E--P--I--Q--C--S--K--M--Q--S--L--L--I--S--N--K--E--L--E--E--Y--K-
CTTTGCTGTCTTAGTCTGCCAGGGAGAAAAAGCAGAACCCATTCAGTGTTCCAAAATGCAGAGTCTCCTCATATCCAACAAAGAGTTGGAAGAATACAAG
:::.::.:::::.:::::::::::.::.:::.:.::::::: .: :::: :::::::::::::::::::..:.::::.: : :: :::::::::::::.:
CTTCGCCGTCTTGGTCTGCCAGGGGGAGAAAACGGAACCCAGCCCGTGTGCCAAAATGCAGAGTCTCCTTGTGTCCAGCCACGATTTGGAAGAATACAGG
--F--A--V--L--V--C--Q--G--E--K--T--E--P--S--P--C--A--K--M--Q--S--L--L--V--S--S--H--D--L--E--E--Y--R-

----------------------------------------------------------------------------------------------------
-E--K--C--F--I--K--L--C--I--T--L--N--E--G--K--S--I--L--C--D--I--N--E--F--S-----F--E--L--K--P--A--R--
GAAAAATGTTTTATCAAACTTTGCATCACCTTAAATGAAGGCAAGAGCATCCTCTGTGATATTAATGAGTTCAGC---TTTGAATTAAAACCTGCTCGGT
.:.::.::::::::::::.:.::: ::::::::.  ::.:::::::::  :..:: :::::::::.::::::::.   ::::::::.::::::::.::  
AAGAAGTGTTTTATCAAATTCTGCCTCACCTTAGCAGAGGGCAAGAGCTGCTCCTTTGATATTAACGAGTTCAGTG--TTTGAATTGAAACCTGCCCGTG
-K--K--C--F--I--K--F--C--L--T--L--A--E--G--K--S--C--S--F--D--I--N--E--F--S--\--F--E--L--K--P--A--R--

----------------------------------------------------------------------------------------------------
L--Y--V--E--D--T--F--V--Y--Y--I--K--T--L--F--D--T--Y--L--P--N--S--R--L--A--G--H--S--T--H--L--S--G--G
TATACGTGGAAGACACATTTGTATACTACATCAAGACTTTGTTTGACACCTACCTTCCTAACAGCAGGTTGGCTGGTCACTCCACACACCTCTCCGGGGG
:.::.::::::::.:::::::: ::.:::.::::.::..::::::: ::::::::::: :.:.::.: ..:::.. :::: :: :.: :::  : :::::
TGTATGTGGAAGATACATTTGTCTATTACGTCAAAACCCTGTTTGAGACCTACCTTCCGAGCGGCGGCCCGGCCACTCACGCCCCGCTCCTGGCGGGGGG
V--Y--V--E--D--T--F--V--Y--Y--V--K--T--L--F--E--T--Y--L--P--S--G--G--P--A--T--H--A--P--L--L--A--G--G

----------------------------------------------------------------------------------------------------
--K--Q--V--L--P--M--Q--V--T--Q--H--A--R--A--L--V--N--P--V--K--L--R--K--L--V--I--Q--P--V--N--L--L--V-
TAAACAGGTGTTGCCCATGCAGGTCACACAGCACGCCAGGGCCTTGGTGAATCCTGTGAAGTTACGGAAACTGGTGATCCAGCCAGTAAATTTGCTCGTC
.: ::::: ::::::: ::::.:::  .:::::::::::::::.::::: :::::::::.:::::::::.:::::::: ::::: ::.::..: ::::::
CACACAGGGGTTGCCCCTGCAAGTCCGGCAGCACGCCAGGGCCCTGGTGCATCCTGTGAGGTTACGGAAGCTGGTGATACAGCCCGTGAACCTCCTCGTC
--T--Q--G--L--P--L--Q--V--R--Q--H--A--R--A--L--V--H--P--V--R--L--R--K--L--V--I--Q--P--V--N--L--L--V-

----------------------------------------------------------------------------------------------------
-S--I--H--A--S--L--K--L--Y--I--A--S--D--H--T--P--L--S--F--S--V--F--E--R--G--P--I--F--T--T--A--R--Q--
AGCATCCACGCTTCCCTCAAGCTGTACATAGCCTCAGACCACACTCCTCTCTCCTTCTCGGTGTTTGAAAGAGGACCCATCTTCACCACTGCGAGGCAGC
:::::::::::.::::::::::::::::: :::::.::::::::::: ::::::::::: :::::.:::::::: :::::::::::::: :: :::::::
AGCATCCACGCCTCCCTCAAGCTGTACATCGCCTCGGACCACACTCCGCTCTCCTTCTCCGTGTTCGAAAGAGGCCCCATCTTCACCACGGCCAGGCAGC
-S--I--H--A--S--L--K--L--Y--I--A--S--D--H--T--P--L--S--F--S--V--F--E--R--G--P--I--F--T--T--A--R--Q--

-----------------------------------------------------------------><---------------------------------
L--V--H--A--L--A--M--H--Y--A--A--G--A--L--F--R--A--G--W--V--V--G--S--L--D--I--L--G--S--P--A--S--L--V
TTGTGCACGCCCTGGCAATGCACTATGCCGCTGGGGCCCTTTTTAGAGCAGGCTGGGTAGTTGGGTCTCTGGATATTCTTGGCAGCCCTGCAAGCCTGGT
: :: :::::.::::: ::::::::.::::: :::::.::.::.::.:::   :::::.:::::.::. :::: ::.::.:::::::: :: :::.::::
TGGTCCACGCTCTGGCCATGCACTACGCCGCGGGGGCTCTCTTCAGGGCA---TGGGTGGTTGGATCCNTGGAAATCCTCGGCAGCCCGGCCAGCTTGGT
L--V--H--A--L--A--M--H--Y--A--A--G--A--L--F--R--A-----W--V--V--G--S--X--E--I--L--G--S--P--A--S--L--V

----------------------------------------------------------------------------------------------------
--R--S--I--G--N--G--V--A--D--F--F--R--L--P--Y--E--G--L--T--R--G--P--G--A--F--V--S--G--V--S--R--G--T-
GAGAAGCATCGGGAACGGGGTCGCCGACTTCTTCAGGCTTCCGTATGAGGGGCTGACCCGGGGCCCTGGAGCCTTCGTGAGTGGCGTCTCCAGAGGGACC
: :::::::.:::::.:: .:::::::::::::::::::::: ::.::::::::::::::.::.::.::::::::.:::::.:: ::.::::::::::: 
GCGAAGCATTGGGAATGGCATCGCCGACTTCTTCAGGCTTCCTTACGAGGGGCTGACCCGAGGTCCCGGAGCCTTTGTGAGCGGGGTTTCCAGAGGGACA
--R--S--I--G--N--G--I--A--D--F--F--R--L--P--Y--E--G--L--T--R--G--P--G--A--F--V--S--G--V--S--R--G--T-

------------------------------------------><--------------------------------------------------------
-T--S--F--V--K--H--I--S--K--G--T--L--T--S--I--T--N--L--A--T--S--L--A--R--N--M--D--R--L--S--L--D--E--
ACATCGTTTGTAAAGCACATCTCCAAAGGTACCCTCACATCCATCACCAACCTCGCCACAAGCCTGGCCCGGAACATGGACCGGCTCTCACTGGATGAGG
::.::.:::::.::::::::.::::::                                                                         
ACGTCATTTGTGAAGCACATTTCCAAA-------------------------------------------------------------------------
-T--S--F--V--K--H--I--S--K--------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
E--H--Y--N--R--Q--E--E--W--R--R--Q--L--P--E--S--L--G--E--G--L--R--Q--G--L--S--R--L--G--I--S--L--L--G
AGCACTACAACCGGCAGGAGGAGTGGCGGCGGCAGCTCCCCGAGAGCCTGGGCGAGGGGCTTCGACAGGGCCTGTCCCGGCTGGGCATCAGCCTGCTTGG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-------------><-------------------------------------------------------------------------------------
--A--I--A--G--I--V--D--Q--P--M--Q--N--F--Q--K--T--S--E--A--Q--A--S--A--G--H--K--A--K--G--V--I--S--G-
TGCAATTGCTGGTATAGTTGATCAGCCGATGCAGAACTTCCAGAAAACATCTGAGGCACAGGCTTCAGCAGGACACAAGGCCAAGGGTGTCATCTCGGGT
 ::::::::::::::::::::::::::.::::::::::::::::::::::::::::: :: :::::.:::::::::::::::::::::::::::::.:::
-GCAATTGCTGGTATAGTTGATCAGCCAATGCAGAACTTCCAGAAAACATCTGAGGCTCATGCTTCGGCAGGACACAAGGCCAAGGGTGTCATCTCAGGT
--A--I--A--G--I--V--D--Q--P--M--Q--N--F--Q--K--T--S--E--A--H--A--S--A--G--H--K--A--K--G--V--I--S--G-

------------------------------------------------------------------------------------------><--------
-V--G--K--G--I--M--G--V--F--T--K--P--I--G--G--A--A--E--L--V--S--Q--T--G--Y--G--I--L--H--G--A--G--L--
GTGGGGAAAGGAATCATGGGGGTGTTCACAAAGCCCATCGGAGGAGCTGCTGAGCTGGTGTCACAGACTGGCTATGGTATTTTACATGGAGCTGGACTTT
:::::::::::::::::::: ::.::::::::::::::::::::.::::::::::: :::::::::::::::                            
GTGGGGAAAGGAATCATGGGCGTATTCACAAAGCCCATCGGAGGGGCTGCTGAGCTCGTGTCACAGACTGGC----------------------------
-V--G--K--G--I--M--G--V--F--T--K--P--I--G--G--A--A--E--L--V--S--Q--T--G-----------------------------

---------------------------------------------------------------------------------------------><-----
S--Q--L--P--K--Q--R--H--Q--P--S--D--L--H--A--D--Q--A--P--N--S--H--V--K--Y--V--W--K--M--L--Q--S--L--G
CTCAGCTTCCCAAACAGCGCCATCAGCCAAGTGATCTACATGCTGACCAGGCTCCAAACAGCCATGTCAAATATGTCTGGAAAATGCTTCAGTCTCTGGG
                                                                                ::::::::::::::::::::
--------------------------------------------------------------------------------AAAATGCTTCAGTCTCTGGG
---------------------------------------------------------------------------------K--M--L--Q--S--L--G

----------------------------------------------------------------------------------------------------
--R--P--E--V--H--M--A--L--D--V--V--L--V--R--G--S--G--Q--E--H--E--G--C--L--L--L--T--S--E--V--L--F--V-
CAGACCAGAAGTCCACATGGCCCTGGACGTGGTTCTGGTGAGGGGCTCAGGCCAGGAGCATGAAGGGTGCTTGCTGCTGACATCAGAAGTGCTCTTCGTG
::::::.:::::.::::::.:::::::.::.:::::::::::::::::.:::::::::::.:::::::::::::::::::::::::::::::::::::::
CAGACCGGAAGTTCACATGACCCTGGATGTAGTTCTGGTGAGGGGCTCGGGCCAGGAGCACGAAGGGTGCTTGCTGCTGACATCAGAAGTGCTCTTCGTG
--R--P--E--V--H--M--T--L--D--V--V--L--V--R--G--S--G--Q--E--H--E--G--C--L--L--L--T--S--E--V--L--F--V-

----------------------------------------------------------------------------------------------------
-V--S--V--S--E--D--T--Q--Q--Q--A--F--P--V--T--E--I--D--C--A--Q--D--S--K--Q--N--N--L--L--T--V--Q--L--
GTGAGTGTCAGTGAGGACACACAGCAGCAGGCCTTCCCCGTCACAGAAATCGACTGTGCACAGGACAGCAAGCAGAACAACTTACTCACAGTGCAGCTCA
:::::::::::.:::::::: :::::::::::::::::::::::.:: ::::::::::::::::::::::::::.:.::::.:.::::. ::::::::::
GTGAGTGTCAGCGAGGACACCCAGCAGCAGGCCTTCCCCGTCACGGACATCGACTGTGCACAGGACAGCAAGCAAAGCAACCTGCTCATCGTGCAGCTCA
-V--S--V--S--E--D--T--Q--Q--Q--A--F--P--V--T--D--I--D--C--A--Q--D--S--K--Q--S--N--L--L--I--V--Q--L--

-------------------------------------------><-------------------------------------------------------
K--Q--P--R--V--A--C--D--V--E--V--D--G--V--R--E--R--L--S--E--Q--Q--Y--N--R--L--V--D--Y--I--T--K--T--S
AGCAGCCAAGAGTGGCCTGTGATGTGGAGGTAGATGGAGTCCGAGAGAGACTGTCAGAGCAACAGTACAACAGACTGGTGGACTACATCACAAAGACATC
:::::::::::::::::::::::::::::   ::::: ...::::::::::::::::::::.:::. .::::.::: :::::::::::::::::::: ::
AGCAGCCAAGAGTGGCCTGTGATGTGGAG---GATGGTACTCGAGAGAGACTGTCAGAGCAGCAGCCTAACAAACTTGTGGACTACATCACAAAGACCTC
K--Q--P--R--V--A--C--D--V--E-----D--G--T--R--E--R--L--S--E--Q--Q--P--N--K--L--V--D--Y--I--T--K--T--S

----------------------------------------------------------------------------------------------------
--C--H--L--A--P--S--C--S--S--M--Q--I--P--C--P--V--V--A--A--E--P--P--P--S--T--V--K--T-----Y--H--Y--L-
TTGTCACCTGGCCCCCAGCTGTTCTTCCATGCAAATACCATGCCCTGTGGTGGCTGCAGAACCTCCCCCCTCCACTGTTAAAACA---TACCATTACCTG
::::::::::::::::::::::::::...::::.:.:::::::::.::::::::::..:::::::. ::::::::::: :::::    :::::.::. ::
TTGTCACCTGGCCCCCAGCTGTTCTTTTGTGCAGACACCATGCCCCGTGGTGGCTGTGGAACCTCTACCCTCCACTGTGAAAACCC--TACCACTATATG
--C--H--L--A--P--S--C--S--F--V--Q--T--P--C--P--V--V--A--V--E--P--L--P--S--T--V--K--T--\--Y--H--Y--M-

------------------------------------------------------------------------------------
-V--D--P--H-----F--A--Q--V--F--L--S--K--F--T--M--V--K--N--K--A--L--R--K--G--F--P--*-
GTTGATCCACAT---TTTGCTCAGGTCTTCCTTAGTAAATTTACCATGGTGAAAAATAAAGCCCTGAGGAAAGGGTTTCCTTGA
::: . :: ::.   :::::.::.:::::: ::::::::::::::::::::::::::::::::::::::::::::::.::::::
GTTCGACC-CACCCTTTTGCCCAAGTCTTCATTAGTAAATTTACCATGGTGAAAAATAAAGCCCTGAGGAAAGGGTTCCCTTGA
-V--R--P--H--P--F--A--Q--V--F--I--S--K--F--T--M--V--K--N--K--A--L--R--K--G--F--P--*-

Pig Consensus Sequence

>BGISUST0000892759
ATGTTAGAGTCATATGTGACTCCAATTTTAATGAGCTATGTGAATCGCTACATCAAGAACTTAAAGCCGTCAGATCTACAGCTTTCACTATGGGGTGGAG
ACGTGGTTCTCAGCAAGCTCGAGTTAAAATTGGATGTGCTGGAGCAG-----------------------------------------------------
-------------------------------------------------------------------------------------------GATGACCAT
GAAAGTTGTGGTTCTAATTCTACCAACCGTAGTACTACTGAGAACACAAAATCATCAGTAAAACCCAGAAGAATTCAACAGGCTGCTCCCGCAGATCCTG
ATTTGCCACCA---TATGTGCAGAGTCTGATTAGACGAGTTGTAAATAATGTAAATATTGTTATAAATAACCTTAGCCTAAAGTATGTGGAAGATGATAT
TGTCCTTTCAGTCAACATCACTTCTGCAGAATGCTATACAGTAGGTGAATTATGGGATCGTGCATTCATGGATATCTCT---ACTGACGTGGTGCTGAGA
AAAGTTATCAATTTTTCTGACTGTACAGTTTGTCTTGATAAACGAAATGCTAGTGGTAAAATAGAATTTTACCAGGACCCTTTATTGTACAAATGTTCCT
TCAGAACTGGTCTGCATTTTACATATGATAACCTCAATTCCAAGATGCCTTCTGTAATTAAA--------------------------------------
----------------------------------------------------------------------------------------------------
---------------------------------------GCCGAAGATGAAACAAGATTAGATATGCAGTATCCTTCTCAGTACAAAGGCCAAGAGTTAT
ATTCACAGCAAGAGGATGAACAGCCACAGGGTTGGGTGTCATGGGCCTGGTCATTTGTGCCTGCAATTGTGAGTTATGATGATGGAGAGGAAGACTACCT
TGGGAATGATCCTACATCAAACACACATCAACAGAAAGCACAGACTTTGAAGGATCCTATTGTTTCTATAGGATTTTATTGTACAAAAGGAACTGTGACT
TTTAAA----------------------------------------------------------------------------------------------
--GCCCTTATGATGGGAGAGCCTTTCTTTGATTGCCAggGTTTAGTAGGTTGCAGAGCCATGTGCCTTAAAGGAATTATGGGTGTTAAAGATTTTGAAGA
GAATATGAATAGAAGTGAAACTGAAGCCTGTTTCTTCATCTGTGGTGAAAATTTAAGTATAAAAGGTTTGACATACCTCACAAATTCA------------
------------------------------------------------------------GAGACATACACTGAGATAGCTGGAATGCAAAGGTTTGGGG
CTTTTTACATGGATTACCTATATACAATGGAGAATACCAATGGCAAA---TCTGCCAATCAGCAAGACTTTTCTTCGGGGAGAAGTGAAGATTTGGGAAC
TGTTCAAGAAAAGTCTACCAAAAGCCTTGTTATAGGACCTCTTGATTTTCGCTTGGATAGCAGTGCAGTACATAGAATTTTAAAAATGATTGTTTGTTCC
TTGGAACATGAATATGAACCATATAGTAGACTAAAA------ACTAAGGATGAAAGTGAAACAGTTCTAAATCCTGAAGAAGTGGCATCTTTGGAGGAAT
ATATTCCTACTCGACATACAAGTGTTACTCTCCTCAAATGTACCTTCACAATTTTCATGGCTGAATTCAACTTGCTGGATCATTTGCTACCTGTCATTAT
GGGAGAAAAG------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------AAGAGATCTCAGATTGCCATAACTGAAGGTATTTTTGAACTTCCAAATCTCACAATTCAAGCTACA
AGAGCACAGACACTTTTGCTTCAAGCAATATATCAAAGTTGGTCTCATACTGGAAATGTCAGCTCTTTAGCAGTGAATGAAGCTTTGATGAATGAAGTTT
TCCAAAGTATA---GTGAAATCTAAGAATCCCTTGCCAACTCTTGAGGGCTCTATCCAGAATGTTGAATTGAAGTACTGCAGCACATCCTTGGTCAAATG
CGCCTCTGGGACCATGGGATCAATAAAAATTTGTGCCAAAGCCCCA------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
-------------------------------------------------------------------------------------------------GGA
AGTGCGCCCTTGGCAAAGCAatCATATCAGGCCTCTGAATATGCCAGCAGTCCTATAAAAACAAAAACAGTAACA---TCCAGACCATTGTCAGTTCCTA
TGAAAGCCATGCTGAATATATCTGAAGGCTGTAGAAGCCCTGAAGAAAGAATGAAAGAATTTATTGGAGTAGTATGGAATGCAGTAAAGAGTCTCACACT
ACAGCTTGAAGTACAATCTTGCTGTGTGTTCATCCCAAATGATAGCTTGCCTTCCCCGAGTACAATTGTATCTGGTGACATTCCTGGAACAGTGAGAAGT
TGGTACCATGGACAAACCAGCATGCCTGGGATGCTTGTCCTCTGTTTGCCTCAAATCAAGATTGTTAGTGCTGGCCACAAGTACATGGAACCTCTGCAGG
AGATTCCATTTGTCATCCCACGACCCATCCTTGAAGAA---GATGCTTTTCCTTGGACCATCAGCTTGCATCATTTCAGCATATATACCCTTTTTGGAAA
ACAAGTAACACTTTGCCTAGTGGAACCTATGGGTTGTACCTCTACTCTAGCTGTTACATCGCAAAAACTGCTCACTGCAGGACCTGATACGAGGCATTCA
TTTGTTGTCTGTCTGCACGTTGACCTAGAGTCACTTGAAATAAAATGCTCGAACCCCCAG----------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
-----------------------------------------------------GAACTAGAAGATCTCAGTGCTTCCATAGATGTCCAGGATGTGTACAC
CAAAGTGAAATGTAAAATAGAAAGTTTCAAtgACCACTACAGAAGC---CTTGGGGAAGAGTGTTGGTCTCTGGGGCAATGTGGAGGTGTCTTCCTCTCC
TGTACTGACAAGCTGAACAGACGCACCTTGTTGGTTCGACCCATCAGCAAggACCCTTTC----------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
-CAGGCAGCAAAGGAAGACACCATGGTTCTGAAGATTGGCTCTGTTGCTATGGCTCCCCAGGCTGACAATCCCCTTGGCAGATCGGTCCTCAGGAAAGAT
ATTTAC------------------------------------------------------------------------------TCCATCAATATTGGTA
CTGCACAGTGGGATCAACTAAAACCAGAGAAGGAAAGTGGAACAGGAGGGGTGCTAACAGAGAATGAAAGAAAtgCTCAGAATCCAGCCCTTGAGTGGAA
TATGGCCAGC---ATACGACGGCATCAAGAAAGAAGAGCAATTTTGACTCCCATTTTAACAGATTTTTCTGTCCGAATAACTGGAGCACCTGCCATCATT
TTCACCAAAATAATTTCTCCAGAAAATATGCACACTGAGGAGATTTTAGTGTGTGGCCATTCCTGGGAAGTGAATATAACCACAAACCTGGACTTCTTCC
TAAGTGTGGCTCAAGTTCAACTCTTACATCAGTTAATAGTAGCAAATATGACTGGACTGGCACCATCAAGCAAAGCCACAGAG-----------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
-----------------------------------------------------------------------------------------TGCCACCACAG
AAAGCAGCGAGTGGAAGTATCCATTTTTGATGCTGTGCTTAAAGGAGTAGCCTCTGATTACAAATGT------CCTGGGAAGACTCTGCCTGAAGCCCTT
GATTACTGCACAGTTTGGCTGCAGACAGTGCCTGGAGAAATAGACAGCAAAAGTGGTATTCCACCTTCCCTTGTGACCCTGCAAATTAAAGACTTCCTTA
ATGGACCA---GACATCCACTTGGATATATCAAAGCCTTTGAAAGCAAACGTGAGTTTTACCAAGCTGGATCAGATAAACAACTTTTTAAAGAAGATACA
AAGTGCACAC------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
-------------------GTCATTCTTGGATCATCATTTGTACTCAGCGTAAATGATTTTCTCCTTAAAACAAGTCTCAAAGAAAGAAGTCGGGTTCTG
ATAGGACCATGCTGTGCTACTGCCAACCTGGAAGCTAAATGGTGTAAACATAGTGGCAACCCAGGCCCAGAACAGTCCATACCAAAAATATCCATTGATT
TAAGAGGAGGTCTGCTCCAGGTTTTCTGGGGTCAAGAACATTTGAATTGCTTGGTTCTTCTACATGAATTACTCAATGGATACCTTAATGAGGAGGGAGC
TTTTGACGTGCAAGCTTCTGAAGCAGTACCACAAATGCCATCTCCTAAAGAAAAGAATCAGATGTTTAAAGGTGAACAAAGTTCAGATGACCTACGGACA
GGT-------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------CCACCG
CAATACCTACAGCCATTTGTTTCCGATAAAAACGTGCCAACTGAACTAGAATATATGATTATTTCCTTCAGAGAACCACACATATATCTGCGACAATGGA
ACAATAGTTCTGTCTGTCAGGAGATCCAGTTCTCAGCTCACGCTGACTGTAAACTTTTGGAGTGCAGAAACGTTACGATGCAAAGCCTGGTGAAGCCCTT
CAGCATCTTTGGACAGGTTGCAGTTTCCAGCAGCGCAGCAGAAAAGCTGATCGACTGCGCCATCGTCATTGACTCTGTATTTGTAAACTTCGGGCAACAT
GTAGTTCACTCTCTAAACACTGCAGTACAAGCTTGGCAACAG----------------------------------------------------------
----------------------------------------------------------------------------------------------------
----CTGTTACACATCTGTATTGAAGGTTGGGGCAATTGGCACTGGTCGGAGCCCTTCAGTGTGGACCACGCTGGTACTTTTATTAGAACTATTCAGTAC
AAGGCTCGAACTGCTTCGCTCATCATCAAGATTCAGCAACTCACCGGAGTGCAAAAACAG----------------------------------------
-----------------------------------------------------------------------------------ACAGCCAAGCAGAAATT
GCCTTCATACATACTCGAAAACAGTGAACTGACCGAGTTGTGTGTGAGGGCCAAAGGAGATGAAAACTGGTCGAGAGACGTGTGCCTGAAATCCAAGGCC
CCTGAGTATAGC----------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
-------------------------------------------------------------------------------------GAAGAAGATGATCCA
TCACATTGTGCCGTCCCCATCTCAACATCCCTCATTAAGCAAATAGCCACTAAGATACACCCAGGAGGGACAGTTAATCAGATCCTCGACGAATTCTATG
GGCCAGAAAAGTCCCTTCAACCCACGTGGCCCTATAATAAAAAGGATTCTGAC-----------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------TTATGCCAGTTCTGCATTTCCTCCATGGTacAAGGCATACAAGTTATTCAGATT
GAAGACAAGACTACAATAATCAATAATACCCCATATCAGATATTTTATAAACCCCAGTTGTCTGTCTCCACACCCCAGTCTGGAAAGGAGTATTTTCACA
TTCCGGACGGTGCTACTTTCAGCCTTCACCCTGGTGGCGAGCAGCCTGCAGTGACGTTCAGCTCCCTTCCTTGCTGGGACTTAAGGCCTGACATCAGTCA
GTCAGCCCTGGATGCATCCCTGCTTCAGAAACAGATCTTGCTGGCCTTTGCTCCTGCCGCAGCAGCCAACAGCTCCCAGTACTGGAGCCTGNCCGCCGTA
GTTAGACAAGAGTTCCCCAGACAAAGTGTGGCAGTGCCCTTGGGGAGCTGTGGGGAAAATGGATTCTGT-------------------------------
----------------------------------------------------------------------------------------------------
-------CCAAAGTTTGAGGTTTATTGCAGAAAAATCCCTCCCGAGTGCTCGGTTCATCATGAGCTGTATCATCAGATGTCCAGTTATCCAGACTGCAAG
ACCAGAGACTTACTTCCAAGCCTCCTCTTGAGAGTAGAATTGCTGGAGGATATGACCACTGAATGGAGTGATGCCATCGACATCAACAATCAGGGAACCC
AGGTTGTGTTCCTGACTGGCTTTGGCTGTGTATACGTGGACACTGTCCATCAGGGTGGCACCATCTTCATCACTGTGGCCCCAGAAGGAAAAGCTGGACC
CATTTTAACTAACACCCAC---------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
--------------------GAGGTCTGCTGCGGGGACCTGCAgcTGGACAACCAGCTGTACAACAAGTCCAATTTCCACTTCGCCGTCTTGGTCTGCCA
GGGGGAGAAAACGGAACCCAGCCCGTGTGCCAAAATGCAGAGTCTCCTTGTGTCCAGCCACGATTTGGAAGAATACAGGAAGAAGTGTTTTATCAAATTC
TGCCTCACCTTAGCAGAGGGCAAGAGCTGCTCCTTTGATATTAACGAGTTCAGttTTGAATTGAAACCTGCCCGTGTGTATGTGGAAGATACATTTGTCT
ATTACGTCAAAACCCTGTTTGAGACCTACCTTCCGAGCGGCGGCCCGGCCACTCACGCCCCGCTCCTGGCGGGGGGCACACAGGGGTTGCCCCTGCAAGT
CCGGCAGCACGCCAGGGCCCTGGTGCATCCTGTGAGGTTACGGAAGCTGGTGATACAGCCCGTGAACCTCCTCGTCAGCATCCACGCCTCCCTCAAGCTG
TACATCGCCTCGGACCACACTCCGCTCTCCTTCTCCGTGTTCGAAAGAGGCCCCATCTTCACCACGGCCAGGCAGCTGGTCCACGCTCTGGCCATGCACT
ACGCCGCGGGGGCTCTCTTCAGGGCA---TGGGTGGTTGGATCCNTGGAAATCCTCGGCAGCCCGGCCAGCTTGGTGCGAAGCATTGGGAATGGCATCGC
CGACTTCTTCAGGCTTCCTTACGAGGGGCTGACCCGAGGTCCCGGAGCCTTTGTGAGCGGGGTTTCCAGAGGGACAACGTCATTTGTGAAGCACATTTCC
AAA-------------------------------------------------------------------------------------------------
-----------------------------------------------------------------------------GCAATTGCTGGTATAGTTGATCA
GCCAATGCAGAACTTCCAGAAAACATCTGAGGCTCATGCTTCGGCAGGACACAAGGCCAAGGGTGTCATCTCAGGTGTGGGGAAAGGAATCATGGGCGTA
TTCACAAAGCCCATCGGAGGGGCTGCTGAGCTCGTGTCACAGACTGGC----------------------------------------------------
--------------------------------------------------------AAAATGCTTCAGTCTCTGGGCAGACCGGAAGTTCACATGACCCT
GGATGTAGTTCTGGTGAGGGGCTCGGGCCAGGAGCACGAAGGGTGCTTGCTGCTGACATCAGAAGTGCTCTTCGTGGTGAGTGTCAGCGAGGACACCCAG
CAGCAGGCCTTCCCCGTCACGGACATCGACTGTGCACAGGACAGCAAGCAAAGCAACCTGCTCATCGTGCAGCTCAAGCAGCCAAGAGTGGCCTGTGATG
TGGAG---GATGGTACTCGAGAGAGACTGTCAGAGCAGCAGCCTAACAAACTTGTGGACTACATCACAAAGACCTCTTGTCACCTGGCCCCCAGCTGTTC
TTTTGTGCAGACACCATGCCCCGTGGTGGCTGTGGAACCTCTACCCTCCACTGTGAAAACctACCACTATATGGTTCGacACCCTTTTGCCCAAGTCTTC
ATTAGTAAATTTACCATGGTGAAAAATAAAGCCCTGAGGAAAGGGTTCCCT


>BGISUSP0000892759
MLESYVTPILMSYVNRYIKNLKPSDLQLSLWGGDVVLSKLELKLDVLEQ------------------------------------------------DDH
ESCGSNSTNRSTTENTKSSVKPRRIQQAAPADPDLPP-YVQSLIRRVVNNVNIVINNLSLKYVEDDIVLSVNITSAECYTVGELWDRAFMDIS-TDVVLR
KVINFSDCTVCLDKRNASGKIEFYQDPLLYKCSFRTGLHFTYDNLNSKMPSVIK----------------------------------------------
-------------AEDETRLDMQYPSQYKGQELYSQQEDEQPQGWVSWAWSFVPAIVSYDDGEEDYLGNDPTSNTHQQKAQTLKDPIVSIGFYCTKGTVT
FK--------------------------------ALMMGEPFFDCQGLVGCRAMCLKGIMGVKDFEENMNRSETEACFFICGENLSIKGLTYLTNS----
--------------------ETYTEIAGMQRFGAFYMDYLYTMENTNGK-SANQQDFSSGRSEDLGTVQEKSTKSLVIGPLDFRLDSSAVHRILKMIVCS
LEHEYEPYSRLK--TKDESETVLNPEEVASLEEYIPTRHTSVTLLKCTFTIFMAEFNLLDHLLPVIMGEK------------------------------
------------------------------------------------------------------------------KRSQIAITEGIFELPNLTIQAT
RAQTLLLQAIYQSWSHTGNVSSLAVNEALMNEVFQSI-VKSKNPLPTLEGSIQNVELKYCSTSLVKCASGTMGSIKICAKAP------------------
---------------------------------------------------------------------------------------------------G
SAPLAKQSYQASEYASSPIKTKTVT-SRPLSVPMKAMLNISEGCRSPEERMKEFIGVVWNAVKSLTLQLEVQSCCVFIPNDSLPSPSTIVSGDIPGTVRS
WYHGQTSMPGMLVLCLPQIKIVSAGHKYMEPLQEIPFVIPRPILEE-DAFPWTISLHHFSIYTLFGKQVTLCLVEPMGCTSTLAVTSQKLLTAGPDTRHS
FVVCLHVDLESLEIKCSNPQ--------------------------------------------------------------------------------
---------------------------------------------------ELEDLSASIDVQDVYTKVKCKIESFNDHYRS-LGEECWSLGQCGGVFLS
CTDKLNRRTLLVRPISKDPF--------------------------------------------------------------------------------
-------------------------------------------------------------------QAAKEDTMVLKIGSVAMAPQADNPLGRSVLRKD
IY--------------------------SINIGTAQWDQLKPEKESGTGGVLTENERNAQNPALEWNMAS-IRRHQERRAILTPILTDFSVRITGAPAII
FTKIISPENMHTEEILVCGHSWEVNITTNLDFFLSVAQVQLLHQLIVANMTGLAPSSKATE---------------------------------------
----------------------------------------------------------------------------------------------------
---------------------------------------------------------------CHHRKQRVEVSIFDAVLKGVASDYKC--PGKTLPEAL
DYCTVWLQTVPGEIDSKSGIPPSLVTLQIKDFLNGP-DIHLDISKPLKANVSFTKLDQINNFLKKIQSAH------------------------------
-------------------------------------------------------------------------VILGSSFVLSVNDFLLKTSLKERSRVL
IGPCCATANLEAKWCKHSGNPGPEQSIPKISIDLRGGLLQVFWGQEHLNCLVLLHELLNGYLNEEGAFDVQASEAVPQMPSPKEKNQMFKGEQSSDDLRT
G---------------------------------------------------------------------------------------------------
--------------------------------------------------------------------------------------------------PP
QYLQPFVSDKNVPTELEYMIISFREPHIYLRQWNNSSVCQEIQFSAHADCKLLECRNVTMQSLVKPFSIFGQVAVSSSAAEKLIDCAIVIDSVFVNFGQH
VVHSLNTAVQAWQQ------------------------------------------------------LLHICIEGWGNWHWSEPFSVDHAGTFIRTIQY
KARTASLIIKIQQLTGVQKQ-----------------------------------------TAKQKLPSYILENSELTELCVRAKGDENWSRDVCLKSKA
PEYS-------------------------------------------------------------------------------------------EEDDP
SHCAVPISTSLIKQIATKIHPGGTVNQILDEFYGPEKSLQPTWPYNKKDSD-------------------------------------------------
----------------------------------------------------------------------------------LCQFCISSMVQGIQVIQI
EDKTTIINNTPYQIFYKPQLSVSTPQSGKEYFHIPDGATFSLHPGGEQPAVTFSSLPCWDLRPDISQSALDASLLQKQILLAFAPAAAANSSQYWSL-AV
VRQEFPRQSVAVPLGSCGENGFC----------------------------------------------PKFEVYCRKIPPECSVHHELYHQMSSYPDCK
TRDLLPSLLLRVELLEDMTTEWSDAIDINNQGTQVVFLTGFGCVYVDTVHQGGTIFITVAPEGKAGPILTNTH---------------------------
----------------------------------------EVCCGDLQLDNQLYNKSNFHFAVLVCQGEKTEPSPCAKMQSLLVSSHDLEEYRKKCFIKF
CLTLAEGKSCSFDINEFSFELKPARVYVEDTFVYYVKTLFETYLPSGGPATHAPLLAGGTQGLPLQVRQHARALVHPVRLRKLVIQPVNLLVSIHASLKL
YIASDHTPLSFSVFERGPIFTTARQLVHALAMHYAAGALFRA-WVVGS-EILGSPASLVRSIGNGIADFFRLPYEGLTRGPGAFVSGVSRGTTSFVKHIS
K----------------------------------------------------------AIAGIVDQPMQNFQKTSEAHASAGHKAKGVISGVGKGIMGV
FTKPIGGAAELVSQTG------------------------------------KMLQSLGRPEVHMTLDVVLVRGSGQEHEGCLLLTSEVLFVVSVSEDTQ
QQAFPVTDIDCAQDSKQSNLLIVQLKQPRVACDVE-DGTRERLSEQQPNKLVDYITKTSCHLAPSCSFVQTPCPVVAVEPLPSTVKTYHYMVRHPFAQVF
ISKFTMVKNKALRKGFP