Sequences
EST Library Info
jca1Joint capsule
pigcb2Unavailable
Clusters
Oligos
SNPs

Gene ID ENSG00000131446 (click for geneview)
Transcript ID ENST00000358563(link to ensembl)
Symbol MGAT1
Localtion Chromosome:5:180150154:180170062:-1 band: 5q35.3
Description Alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase (EC 2.4.1.101) (N-glycosyl-oligosaccharide-glycoprotein N- acetylglucosaminyltransferase I) (GNT-I) (GlcNAc-T I). [Source:Uniprot/SWISSPROT;Acc:P26572]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--L--K--K--Q--S--A--G--L--V--L--W--G--A--I--L--F--V--A--W--N--A--L--L--L--L--F--F--W--T--R--P--A--
ATGCTGAAGAAGCAGTCTGCAGGGCTTGTGCTGTGGGGCGCTATCCTCTTTGTGGCCTGGAATGCCCTGCTGCTCCTCTTCTTCTGGACGCGCCCAGCAC
:::::::::::::::::::::::::::::::::::::::::.::::::::::::::::::::.::::::::::::::::::::.:::::.::::::::.:
ATGCTGAAGAAGCAGTCTGCAGGGCTTGTGCTGTGGGGCGCCATCCTCTTTGTGGCCTGGAACGCCCTGCTGCTCCTCTTCTTTTGGACACGCCCAGCGC
-M--L--K--K--Q--S--A--G--L--V--L--W--G--A--I--L--F--V--A--W--N--A--L--L--L--L--F--F--W--T--R--P--A--

----------------------------------------------------------------------------------------------------
P--G--R--P--P--S--V--S--A--L--D--G--D--P--A--S--L--T--R--E--V--I--R--L--A--Q--D--A--E--V--E--L--E--R
CTGGCAGGCCACCCTCAGTCAGCGCTCTCGATGGCGACCCCGCCAGCCTCACCCGGGAAGTGATTCGCCTGGCCCAAGACGCCGAGGTGGAGCTGGAGCG
:.:::::::..::::::: :::.::.::.::::..:::::::::::::::::::: ::.:::::.:::.:::::::.::.::.:::::::::.:::::::
CCGGCAGGCTGCCCTCAGACAGTGCCCTTGATGATGACCCCGCCAGCCTCACCCGTGAGGTGATCCGCTTGGCCCAGGATGCTGAGGTGGAGTTGGAGCG
P--G--R--L--P--S--D--S--A--L--D--D--D--P--A--S--L--T--R--E--V--I--R--L--A--Q--D--A--E--V--E--L--E--R

----------------------------------------------------------------------------------------------------
--Q--R--G--L--L--Q--Q--I--G--D--------A--L--S--S--Q--R--G--R--V--P--T--A--A--P--P--A--Q--P--R--V--P-
GCAGCGTGGGCTGCTGCAGCAGATCGGGGAT------GCCCTGTCGAGCCAGCGGGGGAGGGTGCCCACCGCGGCCCCTCCCGCCCAGCCGCGTGTGCCT
:::::: ::::::.:::::::::::.::::       ::.  :: :::::::::: :::::::.:::::.:.::::::.::.:. : .::.:::::::::
GCAGCGGGGGCTGTTGCAGCAGATCAGGGAGCACCATGCTAGGTGGAGCCAGCGGTGGAGGGTACCCACTGTGGCCCCCCCTGTGCCACCACGTGTGCCT
--Q--R--G--L--L--Q--Q--I--R--E--H--H--A--R--W--S--Q--R--W--R--V--P--T--V--A--P--P--V--P--P--R--V--P-

----------------------------------------------------------------------------------------------------
-V--T--P--A--P--A--V--I--P--I--L--V--I--A--C--D--R--S--T--V--R--R--C--L--D--K--L--L--H--Y--R--P--S--
GTGACCCCCGCGCCGGCGGTGATTCCCATCCTGGTCATCGCCTGTGACCGCAGCACTGTTCGGCGCTGCCTGGACAAGCTGCTGCATTATCGGCCCTCGG
::::::.:.:::::..: :::::.:::::::::::::::::::::::::::::::::::. :::: :::::::::::::::::::::::.:::::.::.:
GTGACCTCTGCGCCAACTGTGATCCCCATCCTGGTCATCGCCTGTGACCGCAGCACTGTCAGGCGGTGCCTGGACAAGCTGCTGCATTACCGGCCTTCAG
-V--T--S--A--P--T--V--I--P--I--L--V--I--A--C--D--R--S--T--V--R--R--C--L--D--K--L--L--H--Y--R--P--S--

----------------------------------------------------------------------------------------------------
A--E--L--F--P--I--I--V--S--Q--D--C--G--H--E--E--T--A--Q--A--I--A--S--Y--G--S--A--V--T--H--I--R--Q--P
CTGAGCTCTTCCCCATCATCGTTAGCCAGGACTGCGGGCACGAGGAGACGGCCCAGGCCATCGCCTCCTACGGCAGCGCGGTCACGCACATCCGGCAGCC
:::::: :::::::::::::::.:::::::::::.:::::.::::::::.:::::::.:::.::::::::.:::::::: :::::.::::::::::::::
CTGAGCACTTCCCCATCATCGTCAGCCAGGACTGTGGGCATGAGGAGACAGCCCAGGTCATTGCCTCCTATGGCAGCGCTGTCACACACATCCGGCAGCC
A--E--H--F--P--I--I--V--S--Q--D--C--G--H--E--E--T--A--Q--V--I--A--S--Y--G--S--A--V--T--H--I--R--Q--P

----------------------------------------------------------------------------------------------------
--D--L--S--S--I--A--V--P--P--D--H--R--K--F--Q--G--Y--Y--K--I--A--R--H--Y--R--W--A--L--G--Q--V--F--R-
CGACCTGAGCAGCATTGCGGTGCCGCCGGACCACCGCAAGTTCCAGGGCTACTACAAGATCGCGCGCCACTACCGCTGGGCGCTGGGCCAGGTCTTCCGG
 ::::::::::.:::.:..:::::.::  . ::::: :::::::::::::::::.:::::.:: ::.: :::::::::::::::::::::::::::. ..
AGACCTGAGCAACATCGTAGTGCCACCCCGACACCGAAAGTTCCAGGGCTACTATAAGATTGCTCGTCCCTACCGCTGGGCGCTGGGCCAGGTCTTTGAA
--D--L--S--N--I--V--V--P--P--R--H--R--K--F--Q--G--Y--Y--K--I--A--R--P--Y--R--W--A--L--G--Q--V--F--E-

----------------------------------------------------------------------------------------------------
-Q--F--R--F--P--A--A--V--V--V--E--D--D--L--E--V--A--P--D--F--F--E--Y--F--R--A--T--Y--P--L--L--K--A--
CAGTTTCGCTTCCCCGCGGCCGTGGTGGTGGAGGATGACCTGGAGGTGGCCCCGGACTTCTTCGAGTACTTTCGGGCCACCTATCCGCTGCTGAAGGCCG
 ::::. . :::.: :::::.:::::::::::::::::.:::::::::::.::::::::.::.::::::::.:..::::: ::.:::::.::::.:::.:
AAGTTCAAGTTCTCAGCGGCTGTGGTGGTGGAGGATGATCTGGAGGTGGCTCCGGACTTTTTTGAGTACTTCCAAGCCACATACCCGCTACTGAGGGCTG
-K--F--K--F--S--A--A--V--V--V--E--D--D--L--E--V--A--P--D--F--F--E--Y--F--Q--A--T--Y--P--L--L--R--A--

----------------------------------------------------------------------------------------------------
D--P--S--L--W--C--V--S--A--W--N--D--N--G--K--E--Q--M--V--D--A--S--R--P--E--L--L--Y--R--T--D--F--F--P
ACCCCTCCCTGTGGTGCGTCTCGGCCTGGAATGACAACGGCAAGGAGCAGATGGTGGACGCCAGCAGGCCTGAGCTGCTCTACCGCACCGACTTTTTCCC
:::: :: :: :::::.:: :: ::::::::::::::.:::::.::::::::::::::: : ::::.:::.::::::::::::::::: :::::::::::
ACCCGTCACTCTGGTGTGTGTCTGCCTGGAATGACAATGGCAAAGAGCAGATGGTGGACTCGAGCAAGCCCGAGCTGCTCTACCGCACAGACTTTTTCCC
D--P--S--L--W--C--V--S--A--W--N--D--N--G--K--E--Q--M--V--D--S--S--K--P--E--L--L--Y--R--T--D--F--F--P

----------------------------------------------------------------------------------------------------
--G--L--G--W--L--L--L--A--E--L--W--A--E--L--E--P--K--W--P--K--A--F--W--D--D--W--M--R--R--P--E--Q--R-
TGGCCTGGGCTGGCTGCTGTTGGCCGAGCTCTGGGCTGAGCTGGAGCCCAAGTGGCCAAAGGCCTTCTGGGACGACTGGATGCGGCGGCCGGAGCAGCGG
:::::: :::::::::::::::::.:::::::::::.::.::::::::::::::::: :::::::::::::::::::::::::: ::::: :::::::::
TGGCCTTGGCTGGCTGCTGTTGGCTGAGCTCTGGGCCGAACTGGAGCCCAAGTGGCCCAAGGCCTTCTGGGACGACTGGATGCGCCGGCCTGAGCAGCGG
--G--L--G--W--L--L--L--A--E--L--W--A--E--L--E--P--K--W--P--K--A--F--W--D--D--W--M--R--R--P--E--Q--R-

----------------------------------------------------------------------------------------------------
-Q--G--R--A--C--I--R--P--E--I--S--R--T--M--T--F--G--R--K--G--V--S--H--G--Q--F--F--D--Q--H--L--K--F--
CAGGGGCGGGCCTGCATACGCCCTGAGATCTCAAGAACGATGACCTTTGGCCGCAAGGGTGTGAGCCACGGGCAGTTCTTTGACCAGCACCTCAAGTTTA
::::: ::::::::..: :: :::::.::::: :::::::::::::::::::::::::::::::::::.:::::::::::::::::::::::::::::::
CAGGGCCGGGCCTGTGTTCGGCCTGAAATCTCCAGAACGATGACCTTTGGCCGCAAGGGTGTGAGCCATGGGCAGTTCTTTGACCAGCACCTCAAGTTTA
-Q--G--R--A--C--V--R--P--E--I--S--R--T--M--T--F--G--R--K--G--V--S--H--G--Q--F--F--D--Q--H--L--K--F--

----------------------------------------------------------------------------------------------------
I--K--L--N--Q--Q--F--V--H--F--T--Q--L--D--L--S--Y--L--Q--R--E--A--Y--D--R--D--F--L--A--R--V--Y--G--A
TCAAGCTGAACCAGCAGTTTGTGCACTTCACCCAGCTGGACCTGTCTTACCTGCAGCGGGAGGCCTATGACCGAGATTTCCTCGCCCGCGTCTACGGTGC
:::::::::::::::: ::::::: :::::: :::::::::.:::: :::::::..::::::::::::::: :.::::::::::: ::::::::.:::::
TCAAGCTGAACCAGCACTTTGTGCCCTTCACACAGCTGGACTTGTCATACCTGCGACGGGAGGCCTATGACAGGGATTTCCTCGCACGCGTCTATGGTGC
I--K--L--N--Q--H--F--V--P--F--T--Q--L--D--L--S--Y--L--R--R--E--A--Y--D--R--D--F--L--A--R--V--Y--G--A

----------------------------------------------------------------------------------------------------
--P--Q--L--Q--V--E--K--V--R--T--N--D--R--K--E--L--G--E--V--R--V--Q--Y--T--G--R--D--S--F--K--A--F--A-
TCCCCAGCTGCAGGTGGAGAAAGTGAGGACCAATGACCGGAAGGAGCTGGGGGAGGTGCGGGTGCAGTATACGGGCAGGGACAGCTTCAAGGCTTTCGCC
::::: ::::::::::::::::::::::::::.::: ::::. ::::::::::::::::::::::::::.::..:::::::::::::::::::.::::::
TCCCCTGCTGCAGGTGGAGAAAGTGAGGACCAGTGAGCGGAGTGAGCTGGGGGAGGTGCGGGTGCAGTACACAAGCAGGGACAGCTTCAAGGCCTTCGCC
--P--L--L--Q--V--E--K--V--R--T--S--E--R--S--E--L--G--E--V--R--V--Q--Y--T--S--R--D--S--F--K--A--F--A-

----------------------------------------------------------------------------------------------------
-K--A--L--G--V--M--D--D--L--K--S--G--V--P--R--A--G--Y--R--G--I--V--T--F--Q--F--R--G--R--R--V--H--L--
AAGGCTCTGGGTGTCATGGATGACCTTAAGTCGGGGGTTCCGAGAGCTGGCTACCGGGGTATTGTCACCTTCCAGTTCCGGGGCCGCCGTGTCCACCTGG
:::::.::::: ::::::::::::::.::::: :: ::.:: ::.::.:::::::::::.::.:::: ::::. .::::::::::::::::::.::.:::
AAGGCCCTGGGAGTCATGGATGACCTCAAGTCTGGTGTCCCCAGGGCCGGCTACCGGGGCATCGTCAGCTTCTTATTCCGGGGCCGCCGTGTCTACTTGG
-K--A--L--G--V--M--D--D--L--K--S--G--V--P--R--A--G--Y--R--G--I--V--S--F--L--F--R--G--R--R--V--Y--L--

------------------------------------------->
A--P--P--L--T--W--E--G--Y--D--P--S--W--N--*-
CGCCCCCACTGACGTGGGAGGGCTATGATCCTAGCTGGAATTAG
: :::::   ::: ::::: :::::::::::::::::::::   
CTCCCCCTGAGACCTGGGATGGCTATGATCCTAGCTGGAAT---
A--P--P--E--T--W--D--G--Y--D--P--S--W--N----

Pig Consensus Sequence

>BGISUST0000898388
ATGCTGAAGAAGCAGTCTGCAGGGCTTGTGCTGTGGGGCGCCATCCTCTTTGTGGCCTGGAACGCCCTGCTGCTCCTCTTCTTTTGGACACGCCCAGCGC
CCGGCAGGCTGCCCTCAGACAGTGCCCTTGATGATGACCCCGCCAGCCTCACCCGTGAGGTGATCCGCTTGGCCCAGGATGCTGAGGTGGAGTTGGAGCG
GCAGCGGGGGCTGTTGCAGCAGATCAGGGAGCACCATGCTAGGTGGAGCCAGCGGTGGAGGGTACCCACTGTGGCCCCCCCTGTGCCACCACGTGTGCCT
GTGACCTCTGCGCCAACTGTGATCCCCATCCTGGTCATCGCCTGTGACCGCAGCACTGTCAGGCGGTGCCTGGACAAGCTGCTGCATTACCGGCCTTCAG
CTGAGCACTTCCCCATCATCGTCAGCCAGGACTGTGGGCATGAGGAGACAGCCCAGGTCATTGCCTCCTATGGCAGCGCTGTCACACACATCCGGCAGCC
AGACCTGAGCAACATCGTAGTGCCACCCCGACACCGAAAGTTCCAGGGCTACTATAAGATTGCTCGTCCCTACCGCTGGGCGCTGGGCCAGGTCTTTGAA
AAGTTCAAGTTCTCAGCGGCTGTGGTGGTGGAGGATGATCTGGAGGTGGCTCCGGACTTTTTTGAGTACTTCCAAGCCACATACCCGCTACTGAGGGCTG
ACCCGTCACTCTGGTGTGTGTCTGCCTGGAATGACAATGGCAAAGAGCAGATGGTGGACTCGAGCAAGCCCGAGCTGCTCTACCGCACAGACTTTTTCCC
TGGCCTTGGCTGGCTGCTGTTGGCTGAGCTCTGGGCCGAACTGGAGCCCAAGTGGCCCAAGGCCTTCTGGGACGACTGGATGCGCCGGCCTGAGCAGCGG
CAGGGCCGGGCCTGTGTTCGGCCTGAAATCTCCAGAACGATGACCTTTGGCCGCAAGGGTGTGAGCCATGGGCAGTTCTTTGACCAGCACCTCAAGTTTA
TCAAGCTGAACCAGCACTTTGTGCCCTTCACACAGCTGGACTTGTCATACCTGCGACGGGAGGCCTATGACAGGGATTTCCTCGCACGCGTCTATGGTGC
TCCCCTGCTGCAGGTGGAGAAAGTGAGGACCAGTGAGCGGAGTGAGCTGGGGGAGGTGCGGGTGCAGTACACAAGCAGGGACAGCTTCAAGGCCTTCGCC
AAGGCCCTGGGAGTCATGGATGACCTCAAGTCTGGTGTCCCCAGGGCCGGCTACCGGGGCATCGTCAGCTTCTTATTCCGGGGCCGCCGTGTCTACTTGG
CTCCCCCTGAGACCTGGGATGGCTATGATCCTAGC


>BGISUSP0000898388
MLKKQSAGLVLWGAILFVAWNALLLLFFWTRPAPGRLPSDSALDDDPASLTREVIRLAQDAEVELERQRGLLQQIREHHARWSQRWRVPTVAPPVPPRVP
VTSAPTVIPILVIACDRSTVRRCLDKLLHYRPSAEHFPIIVSQDCGHEETAQVIASYGSAVTHIRQPDLSNIVVPPRHRKFQGYYKIARPYRWALGQVFE
KFKFSAAVVVEDDLEVAPDFFEYFQATYPLLRADPSLWCVSAWNDNGKEQMVDSSKPELLYRTDFFPGLGWLLLAELWAELEPKWPKAFWDDWMRRPEQR
QGRACVRPEISRTMTFGRKGVSHGQFFDQHLKFIKLNQHFVPFTQLDLSYLRREAYDRDFLARVYGAPLLQVEKVRTSERSELGEVRVQYTSRDSFKAFA
KALGVMDDLKSGVPRAGYRGIVSFLFRGRRVYLAPPETWDGYDPS