Sequences
EST Library Info
cte2Testicle - RNA from China
ebs2Foetus 50 days, brain stem
nje2Newborn 115 days, jejunum
pigca2Unavailable
pigcb1Unavailable
Clusters
Oligos
SNPs

Gene ID ENSG00000125952 (click for geneview)
Transcript ID ENST00000358664(link to ensembl)
Symbol MAX
Localtion Chromosome:14:64612015:64638941:-1 band: 14q23.3
Description Max protein (Myc associated factor X).
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<----------------------------------><-------------------------><------------------------------------
-M--S--D--N--D--D--I--E--V--E--S--D--E--E--Q--P--R--F--Q--S--A--A--D--K--R--A--H--H--N--A--L--E--R--
ATGAGCGATAACGATGACATCGAGGTGGAGAGCGACGAAGAGCAACCGAGGTTTCAATCTGCGGCTGACAAACGGGCTCATCATAATGCACTGGAACGAA
::::::::::::::::::::::::::::::::::::                           :::::::::::::::::::::::::::::::::::::
ATGAGCGATAACGATGACATCGAGGTGGAGAGCGAC---------------------------GCTGACAAACGGGCTCATCATAATGCACTGGAACGAA
-M--S--D--N--D--D--I--E--V--E--S--D-----------------------------A--D--K--R--A--H--H--N--A--L--E--R--

----------------------------------------------------------------------><----------------------------
K--R--R--D--H--I--K--D--S--F--H--S--L--R--D--S--V--P--S--L--Q--G--E--K--A--S--R--A--Q--I--L--D--K--A
AACGTAGGGACCACATCAAAGACAGCTTTCACAGTTTGCGGGACTCAGTCCCATCACTCCAAGGAGAGAAGGCATCCCGGGCCCAAATCCTAGACAAAGC
::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
AACGTAGGGACCACATCAAAGACAGCTTTCACAGTTTGCGGGACTCAGTCCCATCACTCCAAGGAGAGAAGGCATCCCGGGCCCAAATCCTAGACAAAGC
K--R--R--D--H--I--K--D--S--F--H--S--L--R--D--S--V--P--S--L--Q--G--E--K--A--S--R--A--Q--I--L--D--K--A

----------------------------------------------------------------------------------------------><----
--T--E--Y--I--Q--Y--M--R--R--K--N--H--T--H--Q--Q--D--I--D--D--L--K--R--Q--N--A--L--L--E--Q--Q--V--R-
CACAGAATATATCCAGTATATGCGAAGGAAAAACCACACACACCAGCAAGATATTGACGACCTCAAGCGGCAGAATGCTCTTCTGGAGCAGCAAGTCCGT
::::::.::::::::::::::::::::::::::::::::::::::::::::::::::.::::::::::::::::::::::::::::::::::::   :::
CACAGAGTATATCCAGTATATGCGAAGGAAAAACCACACACACCAGCAAGATATTGATGACCTCAAGCGGCAGAATGCTCTTCTGGAGCAGCAA---CGT
--T--E--Y--I--Q--Y--M--R--R--K--N--H--T--H--Q--Q--D--I--D--D--L--K--R--Q--N--A--L--L--E--Q--Q-----R-

----------------------------------------------------------------------------------------------------
-A--L--E--K--A--R--S--S--A--Q--L--Q--T--N--Y--P--S--S--D--N--S--L--Y--T--N--A--K--G--S--T--I--S--A--
GCACTGGAGAAGGCGAGGTCAAGTGCCCAACTGCAGACCAACTACCCCTCCTCAGACAACAGCCTCTACACCAACGCCAAGGGCAGCACCATCTCTGCCT
::::::::::::::::::::.:::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
GCACTGGAGAAGGCGAGGTCGAGTGCCCAACTGCAGACCAACTACCCCTCCTCAGACAACAGCCTCTACACCAACGCCAAGGGCAGCACCATCTCTGCCT
-A--L--E--K--A--R--S--S--A--Q--L--Q--T--N--Y--P--S--S--D--N--S--L--Y--T--N--A--K--G--S--T--I--S--A--

---------------------------------------------------------------------------------->
F--D--G--G--S--D--S--S--S--E--S--E--P--E--E--P--Q--S--R--K--K--L--R--M--E--A--S--*-
TCGATGGGGGCTCGGACTCCAGCTCGGAGTCTGAGCCTGAAGAGCCCCAAAGCAGGAAGAAGCTCCGGATGGAGGCCAGCTAA
:::::::::::::.::::::::::::::::: :::::.:::::::::::::::::::::::::::::::::::::::::::::
TCGATGGGGGCTCAGACTCCAGCTCGGAGTCGGAGCCCGAAGAGCCCCAAAGCAGGAAGAAGCTCCGGATGGAGGCCAGCTAA
F--D--G--G--S--D--S--S--S--E--S--E--P--E--E--P--Q--S--R--K--K--L--R--M--E--A--S--*-

Pig Consensus Sequence

>BGISUST0000898667
ATGAGCGATAACGATGACATCGAGGTGGAGAGCGAC---------------------------GCTGACAAACGGGCTCATCATAATGCACTGGAACGAA
AACGTAGGGACCACATCAAAGACAGCTTTCACAGTTTGCGGGACTCAGTCCCATCACTCCAAGGAGAGAAGGCATCCCGGGCCCAAATCCTAGACAAAGC
CACAGAGTATATCCAGTATATGCGAAGGAAAAACCACACACACCAGCAAGATATTGATGACCTCAAGCGGCAGAATGCTCTTCTGGAGCAGCAA---CGT
GCACTGGAGAAGGCGAGGTCGAGTGCCCAACTGCAGACCAACTACCCCTCCTCAGACAACAGCCTCTACACCAACGCCAAGGGCAGCACCATCTCTGCCT
TCGATGGGGGCTCAGACTCCAGCTCGGAGTCGGAGCCCGAAGAGCCCCAAAGCAGGAAGAAGCTCCGGATGGAGGCCAGCTAA


>BGISUSP0000898667
MSDNDDIEVESD---------ADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKASRAQILDKATEYIQYMRRKNHTHQQDIDDLKRQNALLEQQ-R
ALEKARSSAQLQTNYPSSDNSLYTNAKGSTISAFDGGSDSSSESEPEEPQSRKKLRMEAS*