Sequences
EST Library Info
cbl1Blood
lnt1Lymphatic nodule tracheobroncalis
pan1Pancreas
pigcb2Unavailable
pliv1Unavailable
thg1Thyroid gland
Clusters
Oligos
SNPs

Gene ID ENSG00000126804 (click for geneview)
Transcript ID ENST00000358738(link to ensembl)
Symbol ZBTB1
Localtion Chromosome:14:64040456:64060368:1 band: 14q23.3
Description Zinc finger and BTB domain containing protein 1. [Source:Uniprot/SWISSPROT;Acc:Q9Y2K1]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--A--K--P--S--H--S--S--Y--V--L--Q--Q--L--N--N--Q--R--E--W--G--F--L--C--D--C--C--I--A--I--D--D--I--
ATGGCAAAGCCCAGCCACAGCAGCTATGTCCTTCAGCAGCTAAACAACCAAAGAGAATGGGGTTTTCTCTGTGACTGCTGTATTGCAATTGATGACATTT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
Y--F--Q--A--H--K--A--V--L--A--A--C--S--S--Y--F--R--M--F--F--M--N--H--Q--H--S--T--A--Q--L--N--L--S--N
ACTTTCAAGCACACAAGGCAGTTCTAGCTGCCTGTAGCTCCTATTTTAGAATGTTTTTCATGAACCATCAGCATAGTACTGCACAACTGAATCTCAGCAA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--M--K--I--S--A--E--C--F--D--L--I--L--Q--F--M--Y--L--G--K--I--M--T--A--P--S--S--F--E--Q--F--K--V--A-
CATGAAAATTAGTGCAGAATGTTTTGATCTCATTTTGCAGTTTATGTATTTAGGAAAAATTATGACAGCTCCCTCCAGTTTTGAGCAGTTTAAAGTGGCA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-M--N--Y--L--Q--L--Y--N--V--P--D--C--L--E--D--I--Q--D--A--D--C--S--S--S--K--C--S--S--S--A--S--S--K--
ATGAACTACCTACAGCTATACAATGTTCCTGACTGTTTAGAAGACATCCAGGATGCAGATTGTTCTAGTTCAAAATGTTCCTCTTCTGCTTCCAGCAAAC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
Q--N--S--K--M--I--F--G--V--R--M--Y--E--D--T--V--A--R--N--G--N--E--A--N--R--W--C--A--E--P--S--S--T--V
AGAACAGCAAAATGATATTTGGGGTAAGAATGTATGAAGATACTGTGGCTCGAAATGGCAATGAAGCCAACAGGTGGTGTGCAGAGCCAAGTTCAACGGT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--N--T--P--H--N--R--E--A--D--E--E--S--L--Q--L--G--N--F--P--E--P--L--F--D--V--C--K--K--S--S--V--S--K-
AAATACACCACATAATAGAGAGGCTGATGAAGAGTCTTTACAATTAGGTAATTTTCCTGAGCCACTATTTGATGTATGTAAAAAAAGTTCCGTGTCCAAA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-L--S--T--P--K--E--R--V--S--R--R--F--G--R--S--F--T--C--D--S--C--G--F--G--F--S--C--E--K--L--L--D--E--
TTATCTACTCCAAAAGAACGTGTGTCAAGACGCTTTGGGCGGAGTTTTACCTGTGATAGCTGTGGATTTGGCTTTAGCTGTGAAAAATTATTAGATGAGC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
H--V--L--T--C--T--N--R--H--L--Y--Q--N--T--R--S--Y--H--R--I--V--D--I--R--D--G--K--D--S--N--I--K--A--E
ATGTGCTAACCTGTACTAACAGACATTTATACCAAAACACAAGATCTTACCATAGAATAGTAGATATTAGAGATGGAAAAGACAGTAACATCAAAGCTGA
                                                                                ::::::::.::::::.::::
--------------------------------------------------------------------------------GACAGTAATATCAAAACTGA
---------------------------------------------------------------------------------D--S--N--I--K--T--D

----------------------------------------------------------------------------------------------------
--F--G--E--K--D--S-----S--K--T--F--S--A--Q--T--D--K--Y--R--G--D--T--S--Q--A--A--D--D--S--A--S--T--T-
ATTTGGTGAAAAAGATTCT---TCCAAAACATTTTCTGCACAGACGGACAAATACAGAGGAGACACAAGCCAGGCTGCTGATGATTCAGCTTCAACCACT
 :::::.: : : ::: .:    :.:::.:::::: :::::::::::::::::::::::::::::::::::::::.:: :::::::::.:::::::::::
CTTTGGCGTATATGATATTC--ACTAAAGCATTTTGTGCACAGACGGACAAATACAGAGGAGACACAAGCCAGGCCGCAGATGATTCAACTTCAACCACT
--F--G--V--Y--D--I--\--T--K--A--F--C--A--Q--T--D--K--Y--R--G--D--T--S--Q--A--A--D--D--S--T--S--T--T-

----------------------------------------------------------------------------------------------------
-G--S--R--K--S--S--T--V--E--S--E--I--A--S--E--E--K--S--R--A--A--E--R--K--R--I--I--I--K--M--E--P--E--
GGAAGCAGAAAAAGTAGCACAGTGGAGTCTGAAATAGCAAGCGAAGAGAAAAGCAGAGCTGCTGAGAGGAAAAGGATTATTATTAAGATGGAGCCAGAAG
::::::::::::::::::::::::::: ::::: :::: ::.:::::.::::::::::::::.:::::::::::.::.:::::.::::::::.::.::::
GGAAGCAGAAAAAGTAGCACAGTGGAGACTGAACTAGCCAGTGAAGAAAAAAGCAGAGCTGCCGAGAGGAAAAGAATCATTATCAAGATGGAACCGGAAG
-G--S--R--K--S--S--T--V--E--T--E--L--A--S--E--E--K--S--R--A--A--E--R--K--R--I--I--I--K--M--E--P--E--

----------------------------------------------------------------------------------------------------
D--I--P--T--D--E--L--K--D--F--N--I--I--K--V--T--D--K--D--C--N--E--S--T--D--N--D--E--L--E--D--E--P--E
ATATTCCTACAGATGAACTGAAAGACTTTAACATTATTAAAGTTACTGATAAAGACTGTAATGAATCCACTGACAATGATGAATTAGAAGATGAACCTGA
::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::.::::::::::::::::::::::::::.::::::::
ATATTCCTACAGATGAACTGAAAGACTTTAACATTATTAAAGTTACTGATAAAGACTGTAATGAGTCCACTGACAATGATGAATTAGAAGACGAACCTGA
D--I--P--T--D--E--L--K--D--F--N--I--I--K--V--T--D--K--D--C--N--E--S--T--D--N--D--E--L--E--D--E--P--E

----------------------------------------------------------------------------------------------------
--E--P--F--Y--R--Y--Y--V--E--E--D--V--S--I--K--K--S--G--R--K--T--L--K--P--R--M--S--V--S--A--D--E--R-
AGAGCCATTTTATAGATACTATGTTGAAGAAGATGTCAGCATAAAAAAAAGTGGTAGGAAAACTCTAAAACCTCGAATGTCAGTAAGTGCTGATGAAAGA
:::::::::::::::::::::::::::::::::::::::.:: :::::.::::: :::::::: :::::::::::.::::::.:::.:::.:::::::::
AGAGCCATTTTATAGATACTATGTTGAAGAAGATGTCAGTATTAAAAAGAGTGGGAGGAAAACGCTAAAACCTCGGATGTCAATAAATGCCGATGAAAGA
--E--P--F--Y--R--Y--Y--V--E--E--D--V--S--I--K--K--S--G--R--K--T--L--K--P--R--M--S--I--N--A--D--E--R-

----------------------------------------------------------------------------------------------------
-G--G--L--E--N--M--R--P--P--N--N--S--S--P--V--Q--E--D--A--E--N--A--S--C--E--L--C--G--L--T--I--T--E--
GGTGGTTTAGAGAATATGAGGCCCCCTAACAACAGCAGTCCAGTACAAGAGGATGCTGAAAATGCATCTTGTGAGCTGTGTGGACTTACAATAACCGAGG
::::::.::::.::.::::::::::: :::::::::::::::::::::::::::.: :::::::::::::::::::: :::::.:::::.::::::::::
GGTGGTCTAGAAAACATGAGGCCCCCAAACAACAGCAGTCCAGTACAAGAGGATACAGAAAATGCATCTTGTGAGCTTTGTGGGCTTACGATAACCGAGG
-G--G--L--E--N--M--R--P--P--N--N--S--S--P--V--Q--E--D--T--E--N--A--S--C--E--L--C--G--L--T--I--T--E--

----------------------------------------------------------------------------------------------------
E--D--L--S--S--H--Y--L--A--K--H--I--E--N--I--C--A--C--G--K--C--G--Q--I--L--V--K--G--R--Q--L--Q--E--H
AGGACCTGTCATCTCATTACTTAGCCAAACACATTGAAAATATCTGTGCATGTGGTAAATGTGGACAAATACTTGTAAAGGGTAGGCAGCTTCAGGAACA
::::::::::.:::::::::::::::::::::::.::::::::::::::::::::.::.::::::::::: :::::.::.:: ::.::::::::::::::
AGGACCTGTCGTCTCATTACTTAGCCAAACACATCGAAAATATCTGTGCATGTGGCAAGTGTGGACAAATCCTTGTGAAAGGAAGACAGCTTCAGGAACA
E--D--L--S--S--H--Y--L--A--K--H--I--E--N--I--C--A--C--G--K--C--G--Q--I--L--V--K--G--R--Q--L--Q--E--H

----------------------------------------------------------------------------------------------------
--A--Q--R--C--G--E--P--Q--D--L--T--M--N--G--L--G--N--T--E--E--K--M--D--L--E--E--N--P--D--E--Q--S--E-
TGCTCAACGATGTGGCGAGCCCCAAGATCTGACCATGAATGGGTTAGGAAATACTGAGGAGAAAATGGACTTGGAAGAGAATCCTGATGAGCAGTCCGAA
:::.::. :.::::: ::::::::::::::::: :::::.::::::::::::.:.::::::::::::::: :::::::::::::::::::::::::.:::
TGCCCAGAGGTGTGGAGAGCCCCAAGATCTGACGATGAACGGGTTAGGAAATGCCGAGGAGAAAATGGACATGGAAGAGAATCCTGATGAGCAGTCTGAA
--A--Q--R--C--G--E--P--Q--D--L--T--M--N--G--L--G--N--A--E--E--K--M--D--M--E--E--N--P--D--E--Q--S--E-

----------------------------------------------------------------------------------------------------
-I--R--D--M--F--V--E--M--L--D--D--F--R--D--N--H--Y--Q--I--N--S--I--Q--K--K--Q--L--F--K--H--S--A--C--
ATAAGAGATATGTTTGTTGAAATGCTGGATGATTTTAGGGACAATCATTACCAGATAAACAGTATCCAAAAAAAGCAGTTATTTAAACATTCTGCCTGCC
:::::.::::::::::::::.:::.:::::::::::::::::::::::: ::::::::::::::::::::::::::::::::::::::::::::::::.:
ATAAGGGATATGTTTGTTGAGATGTTGGATGATTTTAGGGACAATCATTTCCAGATAAACAGTATCCAAAAAAAGCAGTTATTTAAACATTCTGCCTGTC
-I--R--D--M--F--V--E--M--L--D--D--F--R--D--N--H--F--Q--I--N--S--I--Q--K--K--Q--L--F--K--H--S--A--C--

----------------------------------------------------------------------------------------------------
P--F--R--C--P--N--C--G--Q--R--F--E--T--E--N--L--V--V--E--H--M--S--S--C--L--D--Q--D--M--F--K--S--A--I
CTTTTCGATGTCCTAATTGTGGCCAGCGTTTTGAAACTGAAAATCTAGTGGTTGAACATATGTCTAGCTGCTTAGATCAAGATATGTTTAAGAGTGCCAT
:::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::.::::.:::::.:::::::::::::::::
CTTTTCGATGTCCTAATTGTGGCCAGCGTTTTGAAACTGAAAATCTAGTGGTTGAACATATGTCTAGCTGCCTAGACCAAGACATGTTTAAGAGTGCCAT
P--F--R--C--P--N--C--G--Q--R--F--E--T--E--N--L--V--V--E--H--M--S--S--C--L--D--Q--D--M--F--K--S--A--I

----------------------------------------------------------------------------------------------------
--M--E--E--N--E--R--D--H--R--R--K--H--F--C--N--L--C--G--K--G--F--Y--Q--R--C--H--L--R--E--H--Y--T--V-
CATGGAAGAAAATGAAAGAGATCACAGACGAAAGCATTTTTGTAATCTGTGTGGAAAAGGATTTTATCAGCGGTGTCACTTAAGAGAACACTATACTGTT
:::::::::.::.::::::::::::::::::::::::::::::::::::::.::::::::::::::::::::::::::::::::::::::::::::::::
CATGGAAGAGAACGAAAGAGATCACAGACGAAAGCATTTTTGTAATCTGTGCGGAAAAGGATTTTATCAGCGGTGTCACTTAAGAGAACACTATACTGTT
--M--E--E--N--E--R--D--H--R--R--K--H--F--C--N--L--C--G--K--G--F--Y--Q--R--C--H--L--R--E--H--Y--T--V-

----------------------------------------------------------------------------------------------------
-H--T--K--E--K--Q--F--V--C--Q--T--C--G--K--Q--F--L--R--E--R--Q--L--R--L--H--N--D--M--H--K--G--M--A--
CATACTAAGGAAAAACAGTTTGTTTGTCAAACATGTGGAAAGCAGTTTTTAAGAGAGCGTCAGTTGCGACTGCACAATGATATGCACAAAGGCATGGCCA
::::::::::::::.::::::::::::::.::::::::::::::::::::::::::.:::::::::::::::::::::::::::::::::::::::::::
CATACTAAGGAAAAGCAGTTTGTTTGTCAGACATGTGGAAAGCAGTTTTTAAGAGAACGTCAGTTGCGACTGCACAATGATATGCACAAAGGCATGGCCA
-H--T--K--E--K--Q--F--V--C--Q--T--C--G--K--Q--F--L--R--E--R--Q--L--R--L--H--N--D--M--H--K--G--M--A--

----------------------------------------------------------------------------------------------------
R--Y--V--C--S--I--C--D--Q--G--N--F--R--K--H--D--H--V--R--H--M--I--S--H--L--S--A--G--E--T--I--C--Q--V
GGTATGTCTGTTCCATTTGTGATCAAGGAAACTTCAGAAAACATGACCATGTACGGCATATGATTTCTCATTTATCTGCTGGTGAGACTATATGCCAGGT
:::::::::::::::::::::::::::: :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
GGTATGTCTGTTCCATTTGTGATCAAGGCAACTTCAGAAAACATGACCATGTACGGCATATGATTTCTCATTTATCTGCTGGTGAGACTATATGCCAGGT
R--Y--V--C--S--I--C--D--Q--G--N--F--R--K--H--D--H--V--R--H--M--I--S--H--L--S--A--G--E--T--I--C--Q--V

----------------------------------------------------------------------------------------------------
--C--F--Q--I--F--P--N--N--E--Q--L--E--Q--H--M--D--V--H--L--Y--T--C--G--I--C--G--A--K--F--N--L--R--K-
CTGCTTTCAGATATTCCCAAATAATGAACAGTTGGAGCAGCACATGGATGTTCATCTGTATACATGTGGAATATGTGGAGCAAAATTTAATTTGAGGAAA
::::::::::::::::::::::::::::::::::::.:::::::::::::::::::::::::::::::::::::::::::::::.:::::::::::::::
CTGCTTTCAGATATTCCCAAATAATGAACAGTTGGAACAGCACATGGATGTTCATCTGTATACATGTGGAATATGTGGAGCAAAGTTTAATTTGAGGAAA
--C--F--Q--I--F--P--N--N--E--Q--L--E--Q--H--M--D--V--H--L--Y--T--C--G--I--C--G--A--K--F--N--L--R--K-

-------------------------------------------->
-D--M--R--S--H--Y--N--A--K--H--L--K--R--T--*-
GATATGAGATCACATTATAATGCCAAGCATTTGAAAAGAACCTGA
:::::::::::::::::::::::::::::::::::::::      
GATATGAGATCACATTATAATGCCAAGCATTTGAAAAGA------
-D--M--R--S--H--Y--N--A--K--H--L--K--R-------

Pig Consensus Sequence

>BGISUST0000885029
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
--------------------------------------------------------------------------------GACAGTAATATCAAAACTGA
CTTTGGCGTATATGATATtaCTAAAGCATTTTGTGCACAGACGGACAAATACAGAGGAGACACAAGCCAGGCCGCAGATGATTCAACTTCAACCACTGGA
AGCAGAAAAAGTAGCACAGTGGAGACTGAACTAGCCAGTGAAGAAAAAAGCAGAGCTGCCGAGAGGAAAAGAATCATTATCAAGATGGAACCGGAAGATA
TTCCTACAGATGAACTGAAAGACTTTAACATTATTAAAGTTACTGATAAAGACTGTAATGAGTCCACTGACAATGATGAATTAGAAGACGAACCTGAAGA
GCCATTTTATAGATACTATGTTGAAGAAGATGTCAGTATTAAAAAGAGTGGGAGGAAAACGCTAAAACCTCGGATGTCAATAAATGCCGATGAAAGAGGT
GGTCTAGAAAACATGAGGCCCCCAAACAACAGCAGTCCAGTACAAGAGGATACAGAAAATGCATCTTGTGAGCTTTGTGGGCTTACGATAACCGAGGAGG
ACCTGTCGTCTCATTACTTAGCCAAACACATCGAAAATATCTGTGCATGTGGCAAGTGTGGACAAATCCTTGTGAAAGGAAGACAGCTTCAGGAACATGC
CCAGAGGTGTGGAGAGCCCCAAGATCTGACGATGAACGGGTTAGGAAATGCCGAGGAGAAAATGGACATGGAAGAGAATCCTGATGAGCAGTCTGAAATA
AGGGATATGTTTGTTGAGATGTTGGATGATTTTAGGGACAATCATTTCCAGATAAACAGTATCCAAAAAAAGCAGTTATTTAAACATTCTGCCTGTCCTT
TTCGATGTCCTAATTGTGGCCAGCGTTTTGAAACTGAAAATCTAGTGGTTGAACATATGTCTAGCTGCCTAGACCAAGACATGTTTAAGAGTGCCATCAT
GGAAGAGAACGAAAGAGATCACAGACGAAAGCATTTTTGTAATCTGTGCGGAAAAGGATTTTATCAGCGGTGTCACTTAAGAGAACACTATACTGTTCAT
ACTAAGGAAAAGCAGTTTGTTTGTCAGACATGTGGAAAGCAGTTTTTAAGAGAACGTCAGTTGCGACTGCACAATGATATGCACAAAGGCATGGCCAGGT
ATGTCTGTTCCATTTGTGATCAAGGCAACTTCAGAAAACATGACCATGTACGGCATATGATTTCTCATTTATCTGCTGGTGAGACTATATGCCAGGTCTG
CTTTCAGATATTCCCAAATAATGAACAGTTGGAACAGCACATGGATGTTCATCTGTATACATGTGGAATATGTGGAGCAAAGTTTAATTTGAGGAAAGAT
ATGAGATCACATTATAATGCCAAGCATTTGAAAAGA---


>BGISUSP0000885029
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
------------------------------------------------------------DSNIKTDFGVYDITKAFCAQTDKYRGDTSQAADDSTSTTG
SRKSSTVETELASEEKSRAAERKRIIIKMEPEDIPTDELKDFNIIKVTDKDCNESTDNDELEDEPEEPFYRYYVEEDVSIKKSGRKTLKPRMSINADERG
GLENMRPPNNSSPVQEDTENASCELCGLTITEEDLSSHYLAKHIENICACGKCGQILVKGRQLQEHAQRCGEPQDLTMNGLGNAEEKMDMEENPDEQSEI
RDMFVEMLDDFRDNHFQINSIQKKQLFKHSACPFRCPNCGQRFETENLVVEHMSSCLDQDMFKSAIMEENERDHRRKHFCNLCGKGFYQRCHLREHYTVH
TKEKQFVCQTCGKQFLRERQLRLHNDMHKGMARYVCSICDQGNFRKHDHVRHMISHLSAGETICQVCFQIFPNNEQLEQHMDVHLYTCGICGAKFNLRKD
MRSHYNAKHLKR-