Sequences
EST Library Info
cki4Kidney - RNA from China
eep1Foetus 50 days, epidermis
hlv1Heart, left ventricle
nlu1Newborn 115 days, lung
Clusters
Oligos
SNPs

Gene ID ENSG00000069966 (click for geneview)
Transcript ID ENST00000358784(link to ensembl)
Symbol GNB5
Localtion Chromosome:15:50201695:50270857:-1 band: 15q21.2
Description Guanine nucleotide-binding protein beta subunit 5 (Transducin beta chain 5) (Gbeta5). [Source:Uniprot/SWISSPROT;Acc:O14775]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--C--D--Q--T--F--L--V--N--V--F--G--S--C--D--K--C--F--K--Q--R--A--L--R--P--V--F--K--K--S--Q--Q--L--
ATGTGTGATCAGACCTTTCTCGTTAATGTATTTGGCTCATGTGACAAATGTTTCAAACAACGAGCTCTGAGACCAGTTTTCAAGAAGTCTCAACAACTCA
:::::::::::::::::::: ::::::::::::::::: :::::::::::::::::::::::.:::::.:::::::::::::::::.::::::::.::::
ATGTGTGATCAGACCTTTCTAGTTAATGTATTTGGCTCCTGTGACAAATGTTTCAAACAACGGGCTCTAAGACCAGTTTTCAAGAAATCTCAACAGCTCA
-M--C--D--Q--T--F--L--V--N--V--F--G--S--C--D--K--C--F--K--Q--R--A--L--R--P--V--F--K--K--S--Q--Q--L--

-------------------------><-------------------------------------------------------------------------
S--Y--C--S--T--C--A--E--I--M--A--T--E--G--L--H--E--N--E--T--L--A--S--L--K--S--E--A--E--S--L--K--G--K
GCTACTGTTCAACATGTGCAGAAATTATGGCAACCGAGGGGCTGCACGAGAACGAGACGCTGGCGTCGCTGAAGAGCGAGGCCGAGAGCCTCAAGGGCAA
::::.::::::..:::::::::::::::::::::::: ::::::::.::::::::::::::::::::::: :::::::::::::::::::::::::::::
GCTATTGTTCAGTATGTGCAGAAATTATGGCAACCGACGGGCTGCATGAGAACGAGACGCTGGCGTCGCTCAAGAGCGAGGCCGAGAGCCTCAAGGGCAA
S--Y--C--S--V--C--A--E--I--M--A--T--D--G--L--H--E--N--E--T--L--A--S--L--K--S--E--A--E--S--L--K--G--K

-------------------------------------><-------------------------------------------------------------
--L--E--E--E--R--A--K--L--H--D--V--E--L--H--Q--V--A--E--R--V--E--A--L--G--Q--F--V--M--K--T--R--R--T-
GCTGGAGGAGGAGCGAGCCAAGCTGCACGATGTGGAGCTGCACCAGGTGGCGGAGCGGGTGGAGGCCCTGGGGCAGTTTGTCATGAAGACCAGAAGGACC
.::::::::::::::.::::::::::::::.::::::   :::::::::::.::::: :::::::::::::::::::::::::::::::::::.::::::
ACTGGAGGAGGAGCGGGCCAAGCTGCACGACGTGGAG---CACCAGGTGGCAGAGCGTGTGGAGGCCCTGGGGCAGTTTGTCATGAAGACCAGGAGGACC
--L--E--E--E--R--A--K--L--H--D--V--E-----H--Q--V--A--E--R--V--E--A--L--G--Q--F--V--M--K--T--R--R--T-

--------------------------------------------------------------------------><------------------------
-L--K--G--H--G--N--K--V--L--C--M--D--W--C--K--D--K--R--R--I--V--S--S--S--Q--D--G--K--V--I--V--W--D--
CTCAAAGGCCACGGGAACAAAGTCCTGTGCATGGACTGGTGCAAAGATAAGAGGAGGATCGTGAGCTCGTCACAGGATGGGAAGGTGATCGTGTGGGATT
::::::::::::::::::::.::.::::::::::::::::::::.::::::::::::::::::::::: ::.::::::::::::::::::::::::::::
CTCAAAGGCCACGGGAACAAGGTTCTGTGCATGGACTGGTGCAAGGATAAGAGGAGGATCGTGAGCTCCTCGCAGGATGGGAAGGTGATCGTGTGGGATT
-L--K--G--H--G--N--K--V--L--C--M--D--W--C--K--D--K--R--R--I--V--S--S--S--Q--D--G--K--V--I--V--W--D--

----------------><---------------------------------------------------------------------------><-----
S--F--T--T--N--K--E--H--A--V--T--M--P--C--T--W--V--M--A--C--A--Y--A--P--S--G--C--A--I--A--C--G--G--L
CCTTCACCACAAACAAGGAGCACGCGGTCACCATGCCCTGCACGTGGGTGATGGCATGTGCTTATGCCCCATCGGGATGTGCCATTGCTTGTGGTGGTTT
:::::::::: ::::::::.::::::::::::::::::::::::::::::::::::::::: ::.::.:::::.:::::::::::::: :::   :::::
CCTTCACCACCAACAAGGAACACGCGGTCACCATGCCCTGCACGTGGGTGATGGCATGTGCGTACGCTCCATCAGGATGTGCCATTGCATGT---GGTTT
S--F--T--T--N--K--E--H--A--V--T--M--P--C--T--W--V--M--A--C--A--Y--A--P--S--G--C--A--I--A--C-----G--L

----------------------------------------------------------------------------------------------------
--D--N--K--C--S--V--Y--P--L--T--F--D--K--N--E--N--M--A--A--K--K--K--S--V--A--M--H--T--N--Y--L--S--A-
GGATAATAAGTGTTCTGTGTACCCCTTGACGTTTGACAAAAATGAAAACATGGCTGCCAAAAAGAAGTCTGTTGCTATGCACACCAACTACCTGTCGGCC
::::::.::::::::::::::::: .::::::::::::::::::::::::::::.::::::::::::::.::::::::::::::::::::::::::.:::
GGATAACAAGTGTTCTGTGTACCCACTGACGTTTGACAAAAATGAAAACATGGCCGCCAAAAAGAAGTCCGTTGCTATGCACACCAACTACCTGTCAGCC
--D--N--K--C--S--V--Y--P--L--T--F--D--K--N--E--N--M--A--A--K--K--K--S--V--A--M--H--T--N--Y--L--S--A-

--------------------------><------------------------------------------------------------------------
-C--S--F--T--N--S--D--M--Q--I--L--T--A--S--G--D--G--T--C--A--L--W--D--V--E--S--G--Q--L--L--Q--S--F--
TGCAGCTTCACCAACTCTGACATGCAGATCCTGACAGCGAGCGGCGATGGCACATGTGCCCTGTGGGACGTGGAGAGCGGGCAGCTGCTGCAGAGCTTCC
:::::::::::::::::::::::::::::::::::.:: :::::::::::::::::.:::::::::::::::::::::::::::::::::::::::::::
TGCAGCTTCACCAACTCTGACATGCAGATCCTGACGGCCAGCGGCGATGGCACATGCGCCCTGTGGGACGTGGAGAGCGGGCAGCTGCTGCAGAGCTTCC
-C--S--F--T--N--S--D--M--Q--I--L--T--A--S--G--D--G--T--C--A--L--W--D--V--E--S--G--Q--L--L--Q--S--F--

----------------------------------------------------------------------><----------------------------
H--G--H--G--A--D--V--L--C--L--D--L--A--P--S--E--T--G--N--T--F--V--S--G--G--C--D--K--K--A--M--V--W--D
ACGGACATGGGGCTGACGTCCTCTGCTTGGACCTGGCCCCCTCAGAAACTGGAAACACCTTCGTGTCTGGGGGATGTGACAAGAAAGCCATGGTGTGGGA
:.:: ::.:::::.::::: ::::::::::::::::::::::::::.::.::.::::::::.::::::::::::::::::::::::::::::::::::::
ATGGCCACGGGGCCGACGTGCTCTGCTTGGACCTGGCCCCCTCAGAGACCGGGAACACCTTTGTGTCTGGGGGATGTGACAAGAAAGCCATGGTGTGGGA
H--G--H--G--A--D--V--L--C--L--D--L--A--P--S--E--T--G--N--T--F--V--S--G--G--C--D--K--K--A--M--V--W--D

--------------------------------------------------------------><------------------------------------
--M--R--S--G--Q--C--V--Q--A--F--E--T--H--E--S--D--I--N--S--V--R--Y--Y--P--S--G--D--A--F--A--S--G--S-
CATGCGCTCCGGCCAGTGCGTGCAGGCCTTTGAAACACATGAATCTGACATCAACAGTGTCCGGTACTACCCCAGTGGAGATGCCTTTGCTTCAGGGTCA
:::::::::::::::::::.: :::::::::::::::::.:::::::::::::::::::::   :::::.:: ::::::::::::::::::::.::.:::
CATGCGCTCCGGCCAGTGCATTCAGGCCTTTGAAACACACGAATCTGACATCAACAGTGTC---TACTATCCGAGTGGAGATGCCTTTGCTTCGGGATCA
--M--R--S--G--Q--C--I--Q--A--F--E--T--H--E--S--D--I--N--S--V-----Y--Y--P--S--G--D--A--F--A--S--G--S-

-----------><---------------------------------------------------------------------------------------
-D--D--A--T--C--R--L--Y--D--L--R--A--D--R--E--V--A--I--Y--S--K--E--S--I--I--F--G--A--S--S--V--D--F--
GATGACGCTACGTGTCGCCTCTATGACCTGCGGGCAGATAGGGAGGTTGCCATCTATTCCAAAGAAAGCATCATATTTGGAGCATCCAGCGTGGACTTCT
:::::.:::::::::::::::::.::::: ::::::::.:::::::::::::::::::::::.::.::.::::: :::::::: :::::.::::::::::
GATGATGCTACGTGTCGCCTCTACGACCTCCGGGCAGACAGGGAGGTTGCCATCTATTCCAAGGAGAGTATCATCTTTGGAGCTTCCAGTGTGGACTTCT
-D--D--A--T--C--R--L--Y--D--L--R--A--D--R--E--V--A--I--Y--S--K--E--S--I--I--F--G--A--S--S--V--D--F--

--------><------------------------------------------------------------------------------------------
S--L--S--G--R--L--L--F--A--G--Y--N--D--Y--T--I--N--V--W--D--V--L--K--G--S--R--V--S--I--L--F--G--H--E
CCCTCAGTGGTCGCCTGCTGTTTGCTGGATACAATGATTACACTATCAACGTCTGGGATGTTCTCAAAGGGTCCCGGGTCTCCATCCTGTTTGGACATGA
:::::      :::::::::::::::::::::::::::::.::.:::::.:::::::::::.:::::.::.:::::.::::::::::::::.::::::::
CCCTC------CGCCTGCTGTTTGCTGGATACAATGATTATACCATCAATGTCTGGGATGTCCTCAAGGGATCCCGAGTCTCCATCCTGTTCGGACATGA
S--L--------R--L--L--F--A--G--Y--N--D--Y--T--I--N--V--W--D--V--L--K--G--S--R--V--S--I--L--F--G--H--E

---------------------------------------------------------------------------><---------->
--N--R--V--S--T--L--R--V--S--P--D--G--T--A--F--C--S--G--S--W--D--H--T--L--R--V--W--A--*-
AAACCGCGTTAGCACTCTACGAGTTTCCCCCGATGGGACTGCTTTCTGCTCTGGATCATGGGATCATACCCTCAGAGTCTGGGCCTAA
::::::.:::::.:::::::::::::::::.::::::::::::::.::::: ::::::::::::::::: :::               
AAACCGTGTTAGTACTCTACGAGTTTCCCCTGATGGGACTGCTTTTTGCTCAGGATCATGGGATCATACACTC---------------
--N--R--V--S--T--L--R--V--S--P--D--G--T--A--F--C--S--G--S--W--D--H--T--L----------------

Pig Consensus Sequence

>BGISUST0000899342
ATGTGTGATCAGACCTTTCTAGTTAATGTATTTGGCTCCTGTGACAAATGTTTCAAACAACGGGCTCTAAGACCAGTTTTCAAGAAATCTCAACAGCTCA
GCTATTGTTCAGTATGTGCAGAAATTATGGCAACCGACGGGCTGCATGAGAACGAGACGCTGGCGTCGCTCAAGAGCGAGGCCGAGAGCCTCAAGGGCAA
ACTGGAGGAGGAGCGGGCCAAGCTGCACGACGTGGAG---CACCAGGTGGCAGAGCGTGTGGAGGCCCTGGGGCAGTTTGTCATGAAGACCAGGAGGACC
CTCAAAGGCCACGGGAACAAGGTTCTGTGCATGGACTGGTGCAAGGATAAGAGGAGGATCGTGAGCTCCTCGCAGGATGGGAAGGTGATCGTGTGGGATT
CCTTCACCACCAACAAGGAACACGCGGTCACCATGCCCTGCACGTGGGTGATGGCATGTGCGTACGCTCCATCAGGATGTGCCATTGCATGT---GGTTT
GGATAACAAGTGTTCTGTGTACCCACTGACGTTTGACAAAAATGAAAACATGGCCGCCAAAAAGAAGTCCGTTGCTATGCACACCAACTACCTGTCAGCC
TGCAGCTTCACCAACTCTGACATGCAGATCCTGACGGCCAGCGGCGATGGCACATGCGCCCTGTGGGACGTGGAGAGCGGGCAGCTGCTGCAGAGCTTCC
ATGGCCACGGGGCCGACGTGCTCTGCTTGGACCTGGCCCCCTCAGAGACCGGGAACACCTTTGTGTCTGGGGGATGTGACAAGAAAGCCATGGTGTGGGA
CATGCGCTCCGGCCAGTGCATTCAGGCCTTTGAAACACACGAATCTGACATCAACAGTGTC---TACTATCCGAGTGGAGATGCCTTTGCTTCGGGATCA
GATGATGCTACGTGTCGCCTCTACGACCTCCGGGCAGACAGGGAGGTTGCCATCTATTCCAAGGAGAGTATCATCTTTGGAGCTTCCAGTGTGGACTTCT
CCCTC------CGCCTGCTGTTTGCTGGATACAATGATTATACCATCAATGTCTGGGATGTCCTCAAGGGATCCCGAGTCTCCATCCTGTTCGGACATGA
AAACCGTGTTAGTACTCTACGAGTTTCCCCTGATGGGACTGCTTTTTGCTCAGGATCATGGGATCATACACTC---------------


>BGISUSP0000899342
MCDQTFLVNVFGSCDKCFKQRALRPVFKKSQQLSYCSVCAEIMATDGLHENETLASLKSEAESLKGKLEEERAKLHDVE-HQVAERVEALGQFVMKTRRT
LKGHGNKVLCMDWCKDKRRIVSSSQDGKVIVWDSFTTNKEHAVTMPCTWVMACAYAPSGCAIAC-GLDNKCSVYPLTFDKNENMAAKKKSVAMHTNYLSA
CSFTNSDMQILTASGDGTCALWDVESGQLLQSFHGHGADVLCLDLAPSETGNTFVSGGCDKKAMVWDMRSGQCIQAFETHESDINSV-YYPSGDAFASGS
DDATCRLYDLRADREVAIYSKESIIFGASSVDFSL--RLLFAGYNDYTINVWDVLKGSRVSILFGHENRVSTLRVSPDGTAFCSGSWDHTL-----