Sequences
EST Library Info
Clusters
Oligos
SNPs

Gene ID ENSG00000109618 (click for geneview)
Transcript ID ENST00000358971(link to ensembl)
Symbol UGTAP_HUMAN
Localtion Chromosome:4:24798893:24838178:-1 band: 4p15.2
Description soluble liver antigen/liver pancreas antigen
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<----------------------------------------><---------------------------------------------------------
-M--S--T--S--Y--G--C--F--W--R--R--Y--R--A--C--P--E--N--G--W--D--E--S--T--L--E--L--F--L--H--E--L--A--
ATGAGCACCTCATACGGCTGCTTCTGGAGAAGGTACCGAGCTTGTCCAGAGAATGGCTGGGATGAAAGTACACTTGAACTCTTTTTACATGAACTTGCAA
:::::::::::::::::::::::::::::::::         :::::::::.::::.:::::::::::::::::::::::::::.:::::::::::::::
ATGAGCACCTCATACGGCTGCTTCTGGAGAAGG---------TGTCCAGAGGATGGTTGGGATGAAAGTACACTTGAACTCTTTCTACATGAACTTGCAA
-M--S--T--S--Y--G--C--F--W--R--R-----------C--P--E--D--G--W--D--E--S--T--L--E--L--F--L--H--E--L--A--

------------------------------------------------------------------------------------------><--------
I--M--D--S--N--N--F--L--G--N--C--G--V--G--E--R--E--G--R--V--A--S--A--L--V--A--R--R--H--Y--R--F--I--H
TCATGGACAGCAACAATTTCTTAGGCAATTGTGGTGTGGGAGAAAGGGAAGGGAGAGTGGCATCCGCACTGGTTGCTCGTCGTCATTACAGGTTCATTCA
:::::::.::::::::::::.:.:::::.::.:::::::::::::::::: :.:::::.::  ..:::.:.::::::.:  : ::::::   ::::::::
TCATGGATAGCAACAATTTCCTGGGCAACTGCGGTGTGGGAGAAAGGGAACGAAGAGTAGCCATTGCATTAGTTGCTTGGGGACATTAC---TTCATTCA
I--M--D--S--N--N--F--L--G--N--C--G--V--G--E--R--E--R--R--V--A--I--A--L--V--A--W--G--H--Y-----F--I--H

----------------------------------------------------------------------------------------------------
--G--I--G--R--S--G--D--I--S--A--V--Q--P--K--A--A--G--S--S--L--L--N--K--I--T--N--S--L--V--L--D--I--I-
TGGCATTGGACGATCCGGTGATATTTCTGCTGTGCAACCAAAAGCTGCAGGCTCTAGCCTTTTGAACAAAATTACCAATTCTTTGGTCCTGGACATTATA
::: ::::::::::: :::::::::::::::::::::::::::::.:::::.::::::::::::::::::::::::::::::::::: ::::::::.:::
TGGAATTGGACGATCGGGTGATATTTCTGCTGTGCAACCAAAAGCCGCAGGTTCTAGCCTTTTGAACAAAATTACCAATTCTTTGGTGCTGGACATCATA
--G--I--G--R--S--G--D--I--S--A--V--Q--P--K--A--A--G--S--S--L--L--N--K--I--T--N--S--L--V--L--D--I--I-

---------><-----------------------------------------------------------------------------------------
-K--L--A--G--V--H--T--V--A--N--C--F--V--V--P--M--A--T--G--M--S--L--T--L--C--F--L--T--L--R--H--K--R--
AAGCTGGCTGGTGTCCATACAGTAGCCAACTGCTTTGTAGTTCCTATGGCAACTGGTATGAGTCTAACTCTGTGTTTCTTAACATTACGACACAAAAGAC
:::.:::::   :::::::::::..:::::::::::::::::::::::::::::::::::::::::::.::::::::::::::::::::::::::.::::
AAGTTGGCT---GTCCATACAGTGACCAACTGCTTTGTAGTTCCTATGGCAACTGGTATGAGTCTAACCCTGTGTTTCTTAACATTACGACACAAGAGAC
-K--L--A-----V--H--T--V--T--N--C--F--V--V--P--M--A--T--G--M--S--L--T--L--C--F--L--T--L--R--H--K--R--

--------------------------------------------------------------------><------------------------------
P--K--A--K--Y--I--I--W--P--R--I--D--Q--K--S--C--F--K--S--M--I--T--A--G--F--E--P--V--V--I--E--N--V--L
CAAAGGCAAAGTATATTATATGGCCACGAATAGACCAGAAGTCCTGCTTTAAATCCATGATCACTGCAGGTTTTGAGCCTGTGGTGATAGAAAATGTTTT
::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::   ::.::::: :::::::::::.::.:::::
CAAAGGCAAAGTATATTATATGGCCACGAATAGACCAGAAGTCCTGCTTTAAATCCATGATCACTGCA---TTCGAGCCGGTGGTGATAGAGAACGTTTT
P--K--A--K--Y--I--I--W--P--R--I--D--Q--K--S--C--F--K--S--M--I--T--A-----F--E--P--V--V--I--E--N--V--L

----------------------------------------------------------------------------------------------------
--E--G--D--E--L--R--T--D--L--K--A--V--E--A--K--V--Q--E--L--G--P--D--C--I--L--C--I--H--S--T--T--S--C-
GGAAGGTGACGAGCTGCGTACAGACCTGAAAGCAGTGGAGGCTAAAGTCCAGGAACTTGGGCCTGATTGCATTCTGTGTATTCATTCTACTACATCCTGT
.:::::::::::::::::.:::::::::::::::::::::::::::::::::::::::::::::::::...::::::::.:::::::.::::::::::::
AGAAGGTGACGAGCTGCGCACAGACCTGAAAGCAGTGGAGGCTAAAGTCCAGGAACTTGGGCCTGATTATGTTCTGTGTGTTCATTCCACTACATCCTGT
--E--G--D--E--L--R--T--D--L--K--A--V--E--A--K--V--Q--E--L--G--P--D--Y--V--L--C--V--H--S--T--T--S--C-

----------------------><----------------------------------------------------------------------------
-F--A--P--R--V--P--D--R--L--E--E--L--A--V--I--C--A--N--Y--D--I--P--H--I--V--N--N--A--Y--G--V--Q--S--
TTTGCTCCAAGGGTGCCTGATAGATTAGAAGAACTGGCTGTGATTTGTGCTAATTATGACATTCCACATATAGTTAATAATGCTTATGGAGTGCAGTCTT
:::::::::::::::::::::   ::::::::.:::::::::::::::::::::::.:.:::::::::::::::.::.:::::::: :::::::::::::
TTTGCTCCAAGGGTGCCTGAT---TTAGAAGAGCTGGCTGTGATTTGTGCTAATTACGGCATTCCACATATAGTCAACAATGCTTAAGGAGTGCAGTCTT
-F--A--P--R--V--P--D-----L--E--E--L--A--V--I--C--A--N--Y--G--I--P--H--I--V--N--N--A--*--G--V--Q--S--

-------------------------><-------------------------------------------------------------------------
S--K--C--M--H--L--I--Q--Q--G--A--R--V--G--R--I--D--A--F--V--Q--S--L--D--K--N--F--M--V--P--V--G--G--A
CAAAGTGTATGCATCTCATTCAGCAGGGGGCTCGAGTTGGTAGAATAGATGCTTTTGTTCAGAGCTTGGACAAAAATTTTATGGTTCCAGTAGGTGGTGC
:::::::::::::::::::::::::::: ::::::::::::::::::::::::::.::::::::.::::::::::::::::::::::::::::::::.::
CAAAGTGTATGCATCTCATTCAGCAGGGTGCTCGAGTTGGTAGAATAGATGCTTTCGTTCAGAGTTTGGACAAAAATTTTATGGTTCCAGTAGGTGGCGC
S--K--C--M--H--L--I--Q--Q--G--A--R--V--G--R--I--D--A--F--V--Q--S--L--D--K--N--F--M--V--P--V--G--G--A

-------------------------------------------------------><-------------------------------------------
--I--I--A--G--F--N--D--S--F--I--Q--E--I--S--K--M--Y--P--G--R--A--S--A--S--P--S--L--D--V--L--I--T--L-
TATAATTGCTGGCTTTAATGATTCATTCATTCAGGAAATCAGCAAGATGTATCCAGGAAGAGCTTCAGCTTCACCTTCTTTAGATGTCCTTATTACTTTA
:::::::::::::::::::::::: ::::::::::::::::::::::::::::::   ::::::::::::::::::::::::::::::::::::::::::
TATAATTGCTGGCTTTAATGATTCCTTCATTCAGGAAATCAGCAAGATGTATCCA---AGAGCTTCAGCTTCACCTTCTTTAGATGTCCTTATTACTTTA
--I--I--A--G--F--N--D--S--F--I--Q--E--I--S--K--M--Y--P-----R--A--S--A--S--P--S--L--D--V--L--I--T--L-

-----------------------------------------------><---------------------------------------------------
-L--S--L--G--S--N--G--Y--K--K--L--L--K--E--R--K--E--M--F--S--Y--L--S--N--Q--I--K--K--L--S--E--A--Y--
TTGTCACTTGGATCAAATGGCTATAAGAAGCTACTAAAAGAAAGAAAGGAAATGTTTTCATATTTGTCCAACCAAATAAAGAAGTTGTCAGAAGCCTACA
::.:::::::: :::::::::::::::::::::.:.::::::::::::::::::::::::::::::::::::::: ::::::::.:.:::::::::::::
TTATCACTTGGCTCAAATGGCTATAAGAAGCTATTGAAAGAAAGAAAGGAAATGTTTTCATATTTGTCCAACCAACTAAAGAAGCTATCAGAAGCCTACA
-L--S--L--G--S--N--G--Y--K--K--L--L--K--E--R--K--E--M--F--S--Y--L--S--N--Q--L--K--K--L--S--E--A--Y--

-----------------------------------------><---------------------------------------------------------
N--E--R--L--L--H--T--P--H--N--P--I--S--L--A--M--T--L--K--T--L--D--E--H--R--D--K--A--V--T--Q--L--G--S
ATGAAAGACTGTTGCATACACCTCACAATCCCATATCTTTAGCTATGACACTTAAAACACTAGATGAACACCGTGACAAAGCTGTCACTCAGCTTGGCTC
:::::::::::::::::::::::::::::::::::::::::   ::::::::::::::.::::::.:::::.::::.:.:::::::::::::::::::::
ATGAAAGACTGTTGCATACACCTCACAATCCCATATCTTTA---ATGACACTTAAAACGCTAGATAAACACTGTGATAGAGCTGTCACTCAGCTTGGCTC
N--E--R--L--L--H--T--P--H--N--P--I--S--L-----M--T--L--K--T--L--D--K--H--C--D--R--A--V--T--Q--L--G--S

--------------------------------><------------------------------------------------------------------
--M--L--F--T--R--Q--V--S--G--A--R--V--V--P--L--G--S--M--Q--T--V--S--G--Y--T--F--R--G--F--M--S--H--T-
GATGCTTTTTACCAGACAGGTTTCTGGAGCCAGGGTTGTGCCTCTTGGGTCCATGCAAACTGTGAGTGGCTATACTTTCAGAGGCTTTATGTCACATACA
 :::::::::::::::::.::::::::::::   :::::::::::.:::::..:::::::::::::::::::.:::::::::::::::::::::::::::
CATGCTTTTTACCAGACAAGTTTCTGGAGCC---GTTGTGCCTCTCGGGTCTGTGCAAACTGTGAGTGGCTACACTTTCAGAGGCTTTATGTCACATACA
--M--L--F--T--R--Q--V--S--G--A-----V--V--P--L--G--S--V--Q--T--V--S--G--Y--T--F--R--G--F--M--S--H--T-

----------------------------------------------------------------------------------------------------
-N--N--Y--P--C--A--Y--L--N--A--A--S--A--I--G--M--K--M--Q--D--V--D--L--F--I--K--R--L--D--R--C--L--K--
AATAATTACCCTTGTGCTTACCTCAATGCTGCATCAGCCATCGGAATGAAGATGCAGGATGTGGACCTGTTCATAAAGAGACTTGACAGGTGTTTAAAGG
:::::::::::::::::::::::::::::::::::::::::.::::::::::::::::::::::::.:::::::::::::::::::::.:::.::::::.
AATAATTACCCTTGTGCTTACCTCAATGCTGCATCAGCCATTGGAATGAAGATGCAGGATGTGGACTTGTTCATAAAGAGACTTGACAAGTGCTTAAAGA
-N--N--Y--P--C--A--Y--L--N--A--A--S--A--I--G--M--K--M--Q--D--V--D--L--F--I--K--R--L--D--K--C--L--K--

----------------------------------------------------------------------------------------------------
A--V--R--K--E--R--S--K--E--S--D--------------D--N--Y--D--K--T--E--D--V--D--I--E--E--M--A--L--K--L--D
CAGTAAGAAAAGAACGAAGTAAAGAGAGTGAT------------GACAATTATGACAAAACTGAAGATGTGGATATTGAAGAAATGGCTTTAAAACTAGA
:::::::::::::::.:..:.:::::::..:             ::::::::::::::::::::::.:::::::::::::.: :::::::::::::::::
CAGTAAGAAAAGAACAAGATGAAGAGAGCAAGGTATCTGGAGCTGACAATTATGACAAAACTGAAGGTGTGGATATTGAAAACATGGCTTTAAAACTAGA
T--V--R--K--E--Q--D--E--E--S--K--V--S--G--A--D--N--Y--D--K--T--E--G--V--D--I--E--N--M--A--L--K--L--D

--------------------------------------->
--N--V--L--L--D--T--Y--Q--D--A--S--S--*-
TAATGTACTTCTTGACACATACCAGGATGCTTCTTCATGA
:::::::::::::::::::::.:: ::: :::::: ::::
TAATGTACTTCTTGACACATATCATGATTCTTCTTGATGA
--N--V--L--L--D--T--Y--H--D--S--S--*--*-

Pig Consensus Sequence

>BGISUST0000896590
ATGAGCACCTCATACGGCTGCTTCTGGAGAAGG---------TGTCCAGAGGATGGTTGGGATGAAAGTACACTTGAACTCTTTCTACATGAACTTGCAA
TCATGGATAGCAACAATTTCCTGGGCAACTGCGGTGTGGGAGAAAGGGAACGAAGAGTAGCCATTGCATTAGTTGCTTGGGGACATTAC---TTCATTCA
TGGAATTGGACGATCGGGTGATATTTCTGCTGTGCAACCAAAAGCCGCAGGTTCTAGCCTTTTGAACAAAATTACCAATTCTTTGGTGCTGGACATCATA
AAGTTGGCT---GTCCATACAGTGACCAACTGCTTTGTAGTTCCTATGGCAACTGGTATGAGTCTAACCCTGTGTTTCTTAACATTACGACACAAGAGAC
CAAAGGCAAAGTATATTATATGGCCACGAATAGACCAGAAGTCCTGCTTTAAATCCATGATCACTGCA---TTCGAGCCGGTGGTGATAGAGAACGTTTT
AGAAGGTGACGAGCTGCGCACAGACCTGAAAGCAGTGGAGGCTAAAGTCCAGGAACTTGGGCCTGATTATGTTCTGTGTGTTCATTCCACTACATCCTGT
TTTGCTCCAAGGGTGCCTGAT---TTAGAAGAGCTGGCTGTGATTTGTGCTAATTACGGCATTCCACATATAGTCAACAATGCTTAAGGAGTGCAGTCTT
CAAAGTGTATGCATCTCATTCAGCAGGGTGCTCGAGTTGGTAGAATAGATGCTTTCGTTCAGAGTTTGGACAAAAATTTTATGGTTCCAGTAGGTGGCGC
TATAATTGCTGGCTTTAATGATTCCTTCATTCAGGAAATCAGCAAGATGTATCCA---AGAGCTTCAGCTTCACCTTCTTTAGATGTCCTTATTACTTTA
TTATCACTTGGCTCAAATGGCTATAAGAAGCTATTGAAAGAAAGAAAGGAAATGTTTTCATATTTGTCCAACCAACTAAAGAAGCTATCAGAAGCCTACA
ATGAAAGACTGTTGCATACACCTCACAATCCCATATCTTTA---ATGACACTTAAAACGCTAGATAAACACTGTGATAGAGCTGTCACTCAGCTTGGCTC
CATGCTTTTTACCAGACAAGTTTCTGGAGCC---GTTGTGCCTCTCGGGTCTGTGCAAACTGTGAGTGGCTACACTTTCAGAGGCTTTATGTCACATACA
AATAATTACCCTTGTGCTTACCTCAATGCTGCATCAGCCATTGGAATGAAGATGCAGGATGTGGACTTGTTCATAAAGAGACTTGACAAGTGCTTAAAGA
CAGTAAGAAAAGAACAAGATGAAGAGAGCAAGGTATCTGGAGCTGACAATTATGACAAAACTGAAGGTGTGGATATTGAAAACATGGCTTTAAAACTAGA
TAATGTACTTCTTGACACATATCATGAT


>BGISUSP0000896590
MSTSYGCFWRR---CPEDGWDESTLELFLHELAIMDSNNFLGNCGVGERERRVAIALVAWGHY-FIHGIGRSGDISAVQPKAAGSSLLNKITNSLVLDII
KLA-VHTVTNCFVVPMATGMSLTLCFLTLRHKRPKAKYIIWPRIDQKSCFKSMITA-FEPVVIENVLEGDELRTDLKAVEAKVQELGPDYVLCVHSTTSC
FAPRVPD-LEELAVICANYGIPHIVNNA*GVQSSKCMHLIQQGARVGRIDAFVQSLDKNFMVPVGGAIIAGFNDSFIQEISKMYP-RASASPSLDVLITL
LSLGSNGYKKLLKERKEMFSYLSNQLKKLSEAYNERLLHTPHNPISL-MTLKTLDKHCDRAVTQLGSMLFTRQVSGA-VVPLGSVQTVSGYTFRGFMSHT
NNYPCAYLNAASAIGMKMQDVDLFIKRLDKCLKTVRKEQDEESKVSGADNYDKTEGVDIENMALKLDNVLLDTYHD