Sequences
EST Library Info
Clusters
Oligos
SNPs

Gene ID ENSG00000197755 (click for geneview)
Transcript ID ENST00000358991(link to ensembl)
Symbol NP_997364.1
Localtion Chromosome:2:133537738:134159763:-1 band: 2q21.2
Description FLJ34870 protein
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<------------------------------------------------------------------><-------------------------------
-M--D--S--N--K--Y--I--E--H--L--L--T--Q--L--E--E--Q--H--R--S--L--W--R--E--K--L--A--V--A--R--L--Q--R--
ATGGACTCCAATAAATACATTGAGCATCTGCTGACTCAGCTTGAGGAGCAACACAGGAGTCTCTGGAGGGAGAAGTTGGCAGTGGCCCGACTACAGCGAG
   ::::::::::::::::::::.::::::::.:::::::::::::::::.:::::.:::::::::   ::::::.:::: :::::::::::.::: :::
---GACTCCAATAAATACATTGAACATCTGCTAACTCAGCTTGAGGAGCAGCACAGAAGTCTCTGG---GAGAAGCTGGCTGTGGCCCGACTGCAGAGAG
----D--S--N--K--Y--I--E--H--L--L--T--Q--L--E--E--Q--H--R--S--L--W-----E--K--L--A--V--A--R--L--Q--R--

-------------------------------><-------------------------------------------------------------------
E--V--A--Q--R--T--S--E--G--A--M--H--E--K--L--I--H--E--L--E--E--E--R--H--L--R--L--Q--S--E--K--R--L--Q
AAGTTGCCCAAAGAACAAGTGAGGGGGCCATGCATGAGAAGCTGATACATGAACTGGAAGAGGAGAGACACTTACGTCTTCAAAGCGAGAAGCGGTTGCA
::::::::::::::  :::::::::::::::::::::::::::::::::::::.::::::::::::::::::::::::::::.::.::::::::::::::
AAGTTGCCCAAAGACGAAGTGAGGGGGCCATGCATGAGAAGCTGATACATGAATTGGAAGAGGAGAGACACTTACGTCTTCAGAGTGAGAAGCGGTTGCA
E--V--A--Q--R--R--S--E--G--A--M--H--E--K--L--I--H--E--L--E--E--E--R--H--L--R--L--Q--S--E--K--R--L--Q

-----------------------------------------------------------------><---------------------------------
--E--V--T--L--E--S--E--R--N--R--I--Q--M--R--S--L--Q--Q--Q--F--S--R--M--E--E--T--V--R--N--L--L--Q--S-
GGAGGTGACCCTAGAGTCTGAACGCAACAGAATTCAGATGCGTAGCTTGCAGCAGCAGTTCTCCAGGATGGAAGAAACAGTACGAAATCTATTGCAGAGT
::::::::: ::.::::::::. : ::::::::::::::::::.::.:::::::::::::::::   :::::::::::::::::::::::::::::::::
GGAGGTGACACTGGAGTCTGAGAGGAACAGAATTCAGATGCGTGGCCTGCAGCAGCAGTTCTCC---ATGGAAGAAACAGTACGAAATCTATTGCAGAGT
--E--V--T--L--E--S--E--R--N--R--I--Q--M--R--G--L--Q--Q--Q--F--S-----M--E--E--T--V--R--N--L--L--Q--S-

-----------------------------------------------------><---------------------------------------------
-Q--G--S--P--E--Q--K--K--E--E--T--V--N--I--M--V--Y--Q--E--K--L--S--E--E--E--R--K--H--K--E--A--L--E--
CAAGGATCTCCAGAGCAGAAAAAAGAAGAAACTGTTAATATAATGGTCTATCAGGAAAAGCTGTCAGAGGAAGAGAGAAAACATAAGGAAGCTTTGGAAG
::::::::::::::.::::::::::::::::::::::::::::::::::::::::::::.::::::::::::::::::: :::.::.:: .:::::::::
CAAGGATCTCCAGAACAGAAAAAAGAAGAAACTGTTAATATAATGGTCTATCAGGAAAAACTGTCAGAGGAAGAGAGAATACACAAAGACACTTTGGAAG
-Q--G--S--P--E--Q--K--K--E--E--T--V--N--I--M--V--Y--Q--E--K--L--S--E--E--E--R--I--H--K--D--T--L--E--

----------------------------------------------------------------------------------------------------
D--L--H--M--V--V--D--E--D--S--R--S--E--S--S--S--T--D--E--G--K--E--K-----T--K--L--L--L--E--R--L--K--A
ATCTTCACATGGTGGTTGATGAGGATTCGAGGAGTGAAAGCAGCAGTACAGATGAGGGAAAAGAAAAG---ACCAAATTGCTATTAGAGAGATTGAAAGC
:..:.:.::::::::: ::.:::::::: :::::::: .::::::::.::::.::::: :.:::::::   :: ::: ::::.::: :.:::::::::::
ACTTCCGCATGGTGGTAGACGAGGATTCCAGGAGTGACGGCAGCAGTGCAGACGAGGGCAGAGAAAAGC--ACAAAAGTGCTGTTACAAAGATTGAAAGC
D--F--R--M--V--V--D--E--D--S--R--S--D--G--S--S--A--D--E--G--R--E--K--\--T--K--V--L--L--Q--R--L--K--A

------><-----------------><--------->
--L--E--R--A--G--W--R--W--W--P--L--S-
TCTAGAGAGAGCTGGTTGGAGGTGGTGGCCGCTGTCA
:::::::                              
TCTAGAG------------------------------
--L--E-------------------------------

Pig Consensus Sequence

>BGISUST0000897553
---GACTCCAATAAATACATTGAACATCTGCTAACTCAGCTTGAGGAGCAGCACAGAAGTCTCTGG---GAGAAGCTGGCTGTGGCCCGACTGCAGAGAG
AAGTTGCCCAAAGACGAAGTGAGGGGGCCATGCATGAGAAGCTGATACATGAATTGGAAGAGGAGAGACACTTACGTCTTCAGAGTGAGAAGCGGTTGCA
GGAGGTGACACTGGAGTCTGAGAGGAACAGAATTCAGATGCGTGGCCTGCAGCAGCAGTTCTCC---ATGGAAGAAACAGTACGAAATCTATTGCAGAGT
CAAGGATCTCCAGAACAGAAAAAAGAAGAAACTGTTAATATAATGGTCTATCAGGAAAAACTGTCAGAGGAAGAGAGAATACACAAAGACACTTTGGAAG
ACTTCCGCATGGTGGTAGACGAGGATTCCAGGAGTGACGGCAGCAGTGCAGACGAGGGCAGAGAAAAgaCAAAAGTGCTGTTACAAAGATTGAAAGCTCT
AGAG------------------------------


>BGISUSP0000897553
-DSNKYIEHLLTQLEEQHRSLW-EKLAVARLQREVAQRRSEGAMHEKLIHELEEERHLRLQSEKRLQEVTLESERNRIQMRGLQQQFS-MEETVRNLLQS
QGSPEQKKEETVNIMVYQEKLSEEERIHKDTLEDFRMVVDEDSRSDGSSADEGREKTKVLLQRLKALE----------