Sequences
EST Library Info
cad1Unavailable
cbl2Blood
cly2Lymph - RNA from China
fat2Fatt
hyp4Hypothalamus
lnt1Lymphatic nodule tracheobroncalis
nco1Newborn 115 days, colon
nep1Newborn 115 days, epidermis
pgl2Pituitary gland
spl1Spleen
ste2M. Semitendinosus
Clusters
Oligos
SNPs

Gene ID ENSG00000196655 (click for geneview)
Transcript ID ENST00000359005(link to ensembl)
Symbol TRAPPC4
Localtion Chromosome:11:118394451:118399592:1 band: 11q23.3
Description Trafficking protein particle complex subunit 4 (Synbindin) (TRS23 homolog) (Hematopoietic stem/progenitor cell protein 172). [Source:Uniprot/SWISSPROT;Acc:Q9Y296]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--A--I--F--S--V--Y--V--V--N--K--A--G--G--L--I--Y--Q--L--D--S--Y--A--P--R--A--E--A--E--K--T--F--S--
ATGGCGATTTTTAGTGTGTATGTGGTGAACAAAGCTGGCGGCTTGATTTACCAGTTGGACAGCTACGCGCCACGGGCTGAGGCTGAGAAAACTTTCAGTT
:::::::::::.::::::::::::::::::::::::::::::.::::::::::::::::::::::::::::::::::.:::::::::::::: ::.::.:
ATGGCGATTTTCAGTGTGTATGTGGTGAACAAAGCTGGCGGCCTGATTTACCAGTTGGACAGCTACGCGCCACGGGCCGAGGCTGAGAAAACGTTTAGCT
-M--A--I--F--S--V--Y--V--V--N--K--A--G--G--L--I--Y--Q--L--D--S--Y--A--P--R--A--E--A--E--K--T--F--S--

--------------------------------------------------------------------------><------------------------
Y--P--L--D--L--L--L--K--L--H--D--E--R--V--L--V--A--F--G--Q--R--D--G--I--R--V--G--H--A--V--L--A--I--N
ATCCGCTGGATCTGCTGCTCAAGCTACACGATGAGCGTGTGTTGGTTGCTTTCGGCCAGCGGGACGGCATCCGAGTGGGTCATGCAGTGCTGGCCATCAA
:.:: :: :::::::::::::::::.:::::.::::::::..:::::::.::::::::::: :::::::::      ::.::.:::::::::::::::::
ACCCTCTTGATCTGCTGCTCAAGCTGCACGACGAGCGTGTACTGGTTGCCTTCGGCCAGCGCGACGGCATC------GGCCACGCAGTGCTGGCCATCAA
Y--P--L--D--L--L--L--K--L--H--D--E--R--V--L--V--A--F--G--Q--R--D--G--I--------G--H--A--V--L--A--I--N

----------------------------------------------------------------------------------------------------
--G--M--D--V--N--G--R--Y--T--A--D--G--K--E--V--L--E--Y--L--G--N--P--A--N--Y--P--V--S--I--R--F--G--R-
TGGCATGGACGTGAATGGCAGGTACACGGCCGACGGGAAAGAGGTGCTGGAGTATCTGGGTAACCCTGCTAATTACCCGGTGTCCATTCGATTTGGCCGG
:::..:::::::::::::.:..::.::::::::.::::::::::::::::::::.:::::.:::::::::::.::::::::::::::::::::.::::::
TGGTGTGGACGTGAATGGTAAATATACGGCCGATGGGAAAGAGGTGCTGGAGTACCTGGGCAACCCTGCTAACTACCCGGTGTCCATTCGATTCGGCCGG
--G--V--D--V--N--G--K--Y--T--A--D--G--K--E--V--L--E--Y--L--G--N--P--A--N--Y--P--V--S--I--R--F--G--R-

-------------------------------------------------><-------------------------------------------------
-P--R--L--T--S--N--E--K--L--M--L--A--S--M--F--H--S--L--F--A--I--G--S--Q--L--S--P--E--Q--G--S--S--G--
CCCCGCCTCACTTCTAATGAGAAGCTTATGCTGGCCTCCATGTTCCACTCGCTCTTTGCCATCGGCTCCCAGCTGTCTCCTGAACAGGGAAGCTCAGGCA
::.::::::::.:: :::::::::::.:::::::::::::::::::::   :: ::.:: ::::::::::::::::::::::::::::: ::::::::::
CCTCGCCTCACCTCAAATGAGAAGCTCATGCTGGCCTCCATGTTCCAC---CTGTTCGCAATCGGCTCCCAGCTGTCTCCTGAACAGGGCAGCTCAGGCA
-P--R--L--T--S--N--E--K--L--M--L--A--S--M--F--H-----L--F--A--I--G--S--Q--L--S--P--E--Q--G--S--S--G--

-----------------------------------------------------><---------------------------------------------
I--E--M--L--E--T--D--T--F--K--L--H--C--Y--Q--T--L--T--G--I--K--F--V--V--L--A--D--P--R--Q--A--G--I--D
TTGAGATGCTGGAGACAGACACATTCAAATTGCACTGCTACCAGACACTGACAGGGATCAAGTTTGTGGTTCTAGCAGATCCTAGGCAAGCTGGAATAGA
:::::::::::::::::::::::::::::.::::::::: :::.:::::::::   :: ::::::::::: ::.::::::::::::::.:::::.:::::
TTGAGATGCTGGAGACAGACACATTCAAACTGCACTGCTTCCAAACACTGACA---ATAAAGTTTGTGGTGCTGGCAGATCCTAGGCAGGCTGGGATAGA
I--E--M--L--E--T--D--T--F--K--L--H--C--F--Q--T--L--T-----I--K--F--V--V--L--A--D--P--R--Q--A--G--I--D

--------------------------------------------------------------------------------><------------------
--S--L--L--R--K--I--Y--E--I--Y--S--D--F--A--L--K--N--P--F--Y--S--L--E--M--P--I--R--C--E--L--F--D--Q-
TTCTCTTCTCCGAAAGATTTATGAGATTTACTCAGACTTTGCCCTCAAGAATCCATTCTATTCCTTAGAAATGCCTATCAGGTGTGAGCTCTTTGACCAG
.:::::::::::::::::::::::::::::::::::::::::::: :::::::::::.::.:::.:.::::::::.:::   :::::::: :::::::::
CTCTCTTCTCCGAAAGATTTATGAGATTTACTCAGACTTTGCCCTGAAGAATCCATTTTACTCCCTGGAAATGCCCATC---TGTGAGCTGTTTGACCAG
--S--L--L--R--K--I--Y--E--I--Y--S--D--F--A--L--K--N--P--F--Y--S--L--E--M--P--I-----C--E--L--F--D--Q-

----------------------------------------------------------->
-N--L--K--L--A--L--E--V--A--E--K--A--G--T--F--G--P--G--S--*-
AACCTGAAGCTAGCTCTGGAGGTGGCAGAGAAGGCTGGAACTTTTGGACCTGGGTCATAG
:::::::::.::::.::::::::::::::::::::::::::::::::::::::::: :::
AACCTGAAGTTAGCCCTGGAGGTGGCAGAGAAGGCTGGAACTTTTGGACCTGGGTCTTAG
-N--L--K--L--A--L--E--V--A--E--K--A--G--T--F--G--P--G--S--*-

Pig Consensus Sequence

>BGISUST0000882719
ATGGCGATTTTCAGTGTGTATGTGGTGAACAAAGCTGGCGGCCTGATTTACCAGTTGGACAGCTACGCGCCACGGGCCGAGGCTGAGAAAACGTTTAGCT
ACCCTCTTGATCTGCTGCTCAAGCTGCACGACGAGCGTGTACTGGTTGCCTTCGGCCAGCGCGACGGCATC------GGCCACGCAGTGCTGGCCATCAA
TGGTGTGGACGTGAATGGTAAATATACGGCCGATGGGAAAGAGGTGCTGGAGTACCTGGGCAACCCTGCTAACTACCCGGTGTCCATTCGATTCGGCCGG
CCTCGCCTCACCTCAAATGAGAAGCTCATGCTGGCCTCCATGTTCCAC---CTGTTCGCAATCGGCTCCCAGCTGTCTCCTGAACAGGGCAGCTCAGGCA
TTGAGATGCTGGAGACAGACACATTCAAACTGCACTGCTTCCAAACACTGACA---ATAAAGTTTGTGGTGCTGGCAGATCCTAGGCAGGCTGGGATAGA
CTCTCTTCTCCGAAAGATTTATGAGATTTACTCAGACTTTGCCCTGAAGAATCCATTTTACTCCCTGGAAATGCCCATC---TGTGAGCTGTTTGACCAG
AACCTGAAGTTAGCCCTGGAGGTGGCAGAGAAGGCTGGAACTTTTGGACCTGGGTCTTAG


>BGISUSP0000882719
MAIFSVYVVNKAGGLIYQLDSYAPRAEAEKTFSYPLDLLLKLHDERVLVAFGQRDGI--GHAVLAINGVDVNGKYTADGKEVLEYLGNPANYPVSIRFGR
PRLTSNEKLMLASMFH-LFAIGSQLSPEQGSSGIEMLETDTFKLHCFQTLT-IKFVVLADPRQAGIDSLLRKIYEIYSDFALKNPFYSLEMPI-CELFDQ
NLKLALEVAEKAGTFGPGS*