Sequences
EST Library Info
hlv1Heart, left ventricle
lin1Large intestine
ssp1M. Supraspinatus
vin1M. Vastus intermedius
Clusters
Oligos
SNPs

Gene ID ENSG00000197195 (click for geneview)
Transcript ID ENST00000359118(link to ensembl)
Symbol CHURC1
Localtion Chromosome:14:64450921:64470651:1 band: 14q23.3
Description Churchill protein. [Source:Uniprot/SWISSPROT;Acc:Q8WUH1]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<-------------------------------------><------------------------------------------------------------
-M--C--G--D--C--V--E--K--E--Y--P--N--R--G--N--T--C--L--E--N--G--S--F--L--L--N--F--T--G--C--A--V--C--
ATGTGTGGCGACTGTGTGGAGAAGGAATATCCCAACCGGGGTAATACCTGCCTGGAGAATGGATCTTTCTTACTGAACTTTACAGGCTGTGCAGTGTGCA
:::::::: ::::::::::::::::::::::::::: ::   ::.:.::::::::::::::::::::::::.:::::::::::::::::::::::.::::
ATGTGTGGGGACTGTGTGGAGAAGGAATATCCCAACAGG---AACATCTGCCTGGAGAATGGATCTTTCTTGCTGAACTTTACAGGCTGTGCAGTATGCA
-M--C--G--D--C--V--E--K--E--Y--P--N--R-----N--I--C--L--E--N--G--S--F--L--L--N--F--T--G--C--A--V--C--

--------------------------------------------------------------------------><------------------------
S--K--R--D--F--M--L--I--T--N--K--S--L--K--E--E--D--G--E--E--I--V--T--Y--D--H--L--C--K--N--C--H--H--V
GTAAGCGGGATTTTATGCTGATCACAAACAAATCCTTGAAAGAAGAAGATGGAGAAGAAATAGTTACCTATGATCATTTGTGTAAGAATTGTCATCATGT
.:::::::::::::::::::::::::::::::::.:: :::::.::::::::::::::::::::::::::::::   .::::::::::::::::::::::
ATAAGCGGGATTTTATGCTGATCACAAACAAATCTTTCAAAGAGGAAGATGGAGAAGAAATAGTTACCTATGAT---CTGTGTAAGAATTGTCATCATGT
N--K--R--D--F--M--L--I--T--N--K--S--F--K--E--E--D--G--E--E--I--V--T--Y--D-----L--C--K--N--C--H--H--V

---------------------------------------------><-----------------------------------------------------
--I--A--R--H--E--Y--T--F--S--I--M--D--E--F--Q--E--Y--T--M--L--C--L--L--C--G--K--A--E--D--T--I--S--I-
AATAGCCAGACATGAGTATACATTCAGTATCATGGATGAATTTCAGGAGTATACCATGCTGTGTCTGTTATGCGGCAAAGCCGAAGATACTATCAGTATT
 ::::::::.:::::::::::.::::::::::::::::::::::::::::::::::::::::::::::::::.::.::::::::::::::::::::::::
CATAGCCAGGCATGAGTATACGTTCAGTATCATGGATGAATTTCAGGAGTATACCATGCTGTGTCTGTTATGTGGTAAAGCCGAAGATACTATCAGTATT
--I--A--R--H--E--Y--T--F--S--I--M--D--E--F--Q--E--Y--T--M--L--C--L--L--C--G--K--A--E--D--T--I--S--I-

-------------------------------------->
-L--P--D--D--P--R--Q--M--T--L--L--F--*-
CTCCCTGATGACCCCCGACAAATGACTCTCTTATTCTAA
::.::.::::::::::::::::::::::: :::::::::
CTTCCCGATGACCCCCGACAAATGACTCTGTTATTCTAA
-L--P--D--D--P--R--Q--M--T--L--L--F--*-

Pig Consensus Sequence

>BGISUST0000893113
ATGTGTGGGGACTGTGTGGAGAAGGAATATCCCAACAGG---AACATCTGCCTGGAGAATGGATCTTTCTTGCTGAACTTTACAGGCTGTGCAGTATGCA
ATAAGCGGGATTTTATGCTGATCACAAACAAATCTTTCAAAGAGGAAGATGGAGAAGAAATAGTTACCTATGAT---CTGTGTAAGAATTGTCATCATGT
CATAGCCAGGCATGAGTATACGTTCAGTATCATGGATGAATTTCAGGAGTATACCATGCTGTGTCTGTTATGTGGTAAAGCCGAAGATACTATCAGTATT
CTTCCCGATGACCCCCGACAAATGACTCTGTTATTCTAA


>BGISUSP0000893113
MCGDCVEKEYPNR-NICLENGSFLLNFTGCAVCNKRDFMLITNKSFKEEDGEEIVTYD-LCKNCHHVIARHEYTFSIMDEFQEYTMLCLLCGKAEDTISI
LPDDPRQMTLLF*