Sequences
EST Library Info
cst2Stomach - RNA from China
ebs5Foetus 50 days, brain stem
pigcb2Unavailable
sin2Small intestine
Clusters
Oligos
SNPs

Gene ID ENSG00000118058 (click for geneview)
Transcript ID ENST00000359313(link to ensembl)
Symbol MLL
Localtion Chromosome:11:117812438:117898097:1 band: 11q23.3
Description Zinc finger protein HRX (ALL-1) (Trithorax-like protein). [Source:Uniprot/SWISSPROT;Acc:Q03164]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--A--H--S--C--R--W--R--F--P--A--R--P--G--T--T--G--G--G--G--G--G--G--R--R--G--L--G--G--A--P--R--Q--
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCCCCGCGGCAAC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
R--V--P--A--L--L--L--P--P--G--P--P--V--G--G--G--G--P--G--A--P--P--S--P--P--A--V--A--A--A--A--A--A--A
GCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTGGCGGCCGCGGCGGCGGCGGC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--G--S--S--G--A--G--V--P--G--G--A--A--A--A--S--A--A--S--S--S--S--A--S--S--S--S--S--S--S--S--S--A--S-
GGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCGTCTTCGTCTTCGTCATCGTCCTCAGCCTCT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-S--G--P--A--L--L--R--V--G--P--G--F--D--A--A--L--Q--V--S--A--A--I--G--T--N--L--R--R--F--R--A--V--F--
TCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCCGCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTG
   :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
---GGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCCGCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTG
----G--P--A--L--L--R--V--G--P--G--F--D--A--A--L--Q--V--S--A--A--I--G--T--N--L--R--R--F--R--A--V--F--

-------------------------------><-------------------------------------------------------------------
G--E--S--G--G--G--G--G--S--G--E--D--E--Q--F--L--G--F--G--S--D--E--E--V--R--V--R--S--P--T--R--S--P--S
GGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGTTTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTC
::::::::::::::::::::::::::::::::::::::::.:::::::::::::::::::::::::::::::::::.:::::::::::::::::::::::
GGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAGTTCTTAGGTTTTGGCTCAGATGAAGAAGTCAGAGTACGAAGTCCCACAAGGTCTCCTTC
G--E--S--G--G--G--G--G--S--G--E--D--E--Q--F--L--G--F--G--S--D--E--E--V--R--V--R--S--P--T--R--S--P--S

-><-------------------------------------------------------------------------------------------------
--V--K--T--S--P--R--K--P--R--G--R--P--R--S--G--S--D--R--N--S--A--I--L--S--D--P--S--V--F--S--P--L--N-
AGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGAAGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAAT
:                                                                                                   
A---------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-K--S--E--T--K--S--G--D--K--I--K--K--K--D--S--K--S--I--E--K--K--R--G--R--P--P--T--F--P--G--V--K--I--
AAATCAGAGACCAAATCTGGAGATAAGATCAAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
K--I--T--H--G--K--D--I--S--E--L--P--K--G--N--K--E--D--S--L--K--K--I--K--R--T--P--S--A--T--F--Q--Q--A
AAATAACACATGGAAAGGACATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--T--K--I--K--K--L--R--A--G--K--L--S--P--L--K--S--K--F--K--T--G--K--L--Q--I--G--R--K--G--V--Q--I--V-
CACAAAGATTAAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-R--R--R--G--R--P--P--S--T--E--R--I--K--T--P--S--G--L--L--I--N--S--E--L--E--K--P--Q--K--V--R--K--D--
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTCCGGAAAGACA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
K--E--G--T--P--P--L--T--K--E--D--K--T--V--V--R--Q--S--P--R--R--I--K--P--V--R--I--I--P--S--S--K--R--T
AGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATTATTCCTTCTTCAAAAAGGAC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--D--A--T--I--A--K--Q--L--L--Q--R--A--K--K--G--A--Q--K--K--I--E--K--E--A--A--Q--L--Q--G--R--K--V--K-
AGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAAGCAGCTCAGCTGCAGGGAAGAAAGGTGAAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-T--Q--V--K--N--I--R--Q--F--I--M--P--V--V--S--A--I--S--S--R--I--I--K--T--P--R--R--F--I--E--D--E--D--
ACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGGATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
Y--D--P--P--I--K--I--A--R--L--E--S--T--P--N--S--R--F--S--A--P--S--C--G--S--S--E--K--S--S--A--A--S--Q
ATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGATTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--H--S--S--Q--M--S--S--D--S--S--R--S--S--S--P--S--V--D--T--S--T--D--S--Q--A--S--E--E--I--Q--V--L--P-
GCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGTAGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-E--E--R--S--D--T--P--E--V--H--P--P--L--P--I--S--Q--S--P--E--N--E--S--N--D--R--R--S--R--R--Y--S--V--
GAGGAGCGGAGCGATACCCCTGAAGTTCATCCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
S--E--R--S--F--G--S--R--T--T--K--K--L--S--T--L--Q--S--A--P--Q--Q--Q--T--S--S--S--P--P--P--P--L--L--T
CGGAGAGAAGTTTTGGATCTAGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGAC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--P--P--P--P--L--Q--P--A--S--S--I--S--D--H--T--P--W--L--M--P--P--T--I--P--L--A--S--P--F--L--P--A--S-
TCCACCGCCACCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-T--A--P--M--Q--G--K--R--K--S--I--L--R--E--P--T--F--R--W--T--S--L--K--H--S--R--S--E--P--Q--Y--F--S--
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAATACTTTTCCT
                                                                                    :::::.::::::::::
------------------------------------------------------------------------------------CCACAGTACTTTTCCT
-------------------------------------------------------------------------------------P--Q--Y--F--S--

----------------------------------------------------------------------------------------------------
S--A--K--Y--A--K--E--G--L--I--R--K--P--I--F--D--N--F--R--P--P--P--L--T--P--E--D--V--G--F--A--S--G--F
CAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGACGTTGGCTTTGCATCTGGTTT
::::::::::::::::::::::::::::::::::::::::::::::::::::::: :::::::::::::::::.:::::.::.:::::.:::::.:: ::
CAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGCCCCCCTCCACTAACTCCTGAGGATGTCGGCTTCGCATCCGGGTT
S--A--K--Y--A--K--E--G--L--I--R--K--P--I--F--D--N--F--R--P--P--P--L--T--P--E--D--V--G--F--A--S--G--F

----------------------------------------------------------------------------------------------------
--S--A--S--G--T--A--A--S--A--R--L--F--S--P--L--H--S--G--T--R--F--D--M--H--K--R--S--P--L--L--R--A--P-
TTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATGCACAAAAGGAGCCCTCTTCTGAGAGCTCCA
::::.::::::::::.:::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: :::::::::::::::::::::::
TTCTACATCTGGTACTGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATGCACAAACGGAGCCCTCTTCTGAGAGCTCCA
--S--T--S--G--T--A--A--S--A--R--L--F--S--P--L--H--S--G--T--R--F--D--M--H--K--R--S--P--L--L--R--A--P-

----------------------------------------------------------------------------------------------------
-R--F--T--P--S--E--A--H--S--R--I--F--E--S--V--T--L--P--S--N--R--T--S--A--G--T--S--S--S--G--V--S--N--
AGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAATCGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATA
::::::::::::::.::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: :::: ::.:
AGATTTACTCCAAGCGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAATCGAACTTCTGCTGGAACATCTTCTTCAGGATTATCGAACA
-R--F--T--P--S--E--A--H--S--R--I--F--E--S--V--T--L--P--S--N--R--T--S--A--G--T--S--S--S--G--L--S--N--

----------------------------------------------------------------------------------------------------
R--K--R--K--R--K--V--F--S--P--I--R--S--E--P--R--S--P--S--H--S--M--R--T--R--S--G--R--L--S--S--S--E--L
GAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCTCCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCT
:.:::::::::::::::::::::::.::::::::::::::::::::::::::::::::::::::::::::::::::.:::::::::::.: ::: :::::
GGAAAAGGAAAAGAAAAGTGTTTAGCCCTATTCGATCTGAACCAAGATCTCCTTCTCACTCCATGAGGACAAGAAGCGGAAGGCTTAGCACTTCGGAGCT
R--K--R--K--R--K--V--F--S--P--I--R--S--E--P--R--S--P--S--H--S--M--R--T--R--S--G--R--L--S--T--S--E--L

----------------------------------------------------------------------------------------------------
--S--P--L--T--P--P--S--S--V--S--S--S--L--S--I--S--V--S--P--L--A--T--S--A--L--N--P--T--F--T--F--P--S-
CTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTAAGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCT
 :::::::::::::: ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
GTCACCTCTCACCCCACCGTCTTCTGTCTCTTCCTCGTTAAGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCT
--S--P--L--T--P--P--S--S--V--S--S--S--L--S--I--S--V--S--P--L--A--T--S--A--L--N--P--T--F--T--F--P--S-

----------------------------------------------------------------------------------------------------
-H--S--L--T--Q--S--G--E--S--A--E--K--N--Q--R--P--R--K--Q--T--S--A--P--A--E--P--F--S--S--S--S--P--T--
CATTCCCTGACTCAGTCTGGGGAATCTGCAGAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTC
::::::::::::::::::::::::::::::::::::::.::::::::::::::::::::::::::::::::::::::::::::::: ::::::::.::::
CATTCCCTGACTCAGTCTGGGGAATCTGCAGAGAAAAACCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCCAGTAGTCCCACTC
-H--S--L--T--Q--S--G--E--S--A--E--K--N--Q--R--P--R--K--Q--T--S--A--P--A--E--P--F--S--S--S--S--P--T--

----------------------------------------------------------------------------------------------------
P--L--F--P--W--F--T--P--G--S--Q--T--E--R--G--R--N--K--D--K--A--P--E--E--L--S--K--D--R--D--A--D--K--S
CTCTCTTCCCTTGGTTTACCCCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAG
::::::: ::.:::::::::::::::::::::::::::::::::::.:::::::::::::::::.::::::::::::::::: :::::::::::::::::
CTCTCTT-CCCTGGTTTACCCCAGGCTCTCAGACTGAAAGAGGGAGGAATAAAGACAAGGCCCCTGAGGAGCTGTCCAAAGAGCGAGATGCTGACAAGAG
P--L--F--P--W--F--T--P--G--S--Q--T--E--R--G--R--N--K--D--K--A--P--E--E--L--S--K--E--R--D--A--D--K--S

----------------------------------------------------------------------------------------------------
--V--E--K--D--K--S--R--E--R--D--R--E--R--E--K--E--N--K--R--E--S--R--K--E--K--R--K--K--G--S--E--I--Q-
CGTGGAGAAGGACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
:::::::::::::::::::::::::::::::::::::::::::::.::::::::::::::::: ::::::::::::::::::::::::::::::::::::
CGTGGAGAAGGACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAAGAGAATAAGCGGGAGTCCAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
--V--E--K--D--K--S--R--E--R--D--R--E--R--E--K--E--N--K--R--E--S--R--K--E--K--R--K--K--G--S--E--I--Q-

----------------------------------------------------------------------------------------------------
-S--S--S--A--L--Y--P--V--G--R--V--S--K--E--K--V--V--G--E--D--V--A--T--S--S--S--A--K--K--A--T--G--R--
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCAACAGGGCGGA
:::::.:::::::::::::::::::::::::::::::::::::::::.::::.::::::::: :::::::::::::::::::::::::::::::::::::
AGTAGCTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTCGTTGATGAAGATGTGGCCACTTCATCTTCTGCCAAAAAAGCAACAGGGCGGA
-S--S--S--A--L--Y--P--V--G--R--V--S--K--E--K--V--V--D--E--D--V--A--T--S--S--S--A--K--K--A--T--G--R--

----------------------------------------------------------------------------------------------------
K--K--S--S--S--H--D--S--G--T--D--I--T--S--V--T--L--G--D--T--T--A--V--K--T--K--I--L--I--K--K--G--R--G
AGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATACTTATAAAGAAAGGGAGAGG
::::::::::::::: :::::::::::::::::::.::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
AGAAGTCTTCATCACTTGATTCTGGGACTGATATTGCTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATACTTATAAAGAAAGGGAGAGG
K--K--S--S--S--L--D--S--G--T--D--I--A--S--V--T--L--G--D--T--T--A--V--K--T--K--I--L--I--K--K--G--R--G

----------------------------------------------------------------------------------------------------
--N--L--E--K--T--N--L--D--L--G--P--T--A--P--S--L--E--K--E--K--T--L--C--L--S--T--P--S--S--S--T--V--K-
AAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGCCTTTCCACTCCTTCATCTAGCACTGTTAAA
:::::::::::::: :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
AAATCTGGAAAAAAACAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGCCTTTCCACTCCTTCATCTAGCACTGTTAAA
--N--L--E--K--N--N--L--D--L--G--P--T--A--P--S--L--E--K--E--K--T--L--C--L--S--T--P--S--S--S--T--V--K-

----------------------------------------------------------------------------------------------------
-H--S--T--S--S--I--G--S--M--L--A--Q--A--D--K--L--P--M--T--D--K--R--V--A--S--L--L--K--K--A--K--A--Q--
CATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGACAAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGC
:::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::.::::
CATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGACAAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCCCAGC
-H--S--T--S--S--I--G--S--M--L--A--Q--A--D--K--L--P--M--T--D--K--R--V--A--S--L--L--K--K--A--K--A--Q--

----------------------------------------------------------><----------------------------------------
L--C--K--I--E--K--S--K--S--L--K--Q--T--D--Q--P--K--A--Q--G--Q--E--S--D--S--S--E--T--S--V--R--G--P--R
TCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAAGCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCG
::::::::::::::::::::::::::::::::::.::.:::::::::::::::::::::::::::::::::::.::.:::::::: ::::::::::::::
TCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAGACTGACCAGCCCAAAGCACAGGGTCAAGAAAGTGACTCGTCGGAGACCTCAGTGCGAGGACCCCG
L--C--K--I--E--K--S--K--S--L--K--Q--T--D--Q--P--K--A--Q--G--Q--E--S--D--S--S--E--T--S--V--R--G--P--R

----------------------------------------------------------------------------------------------------
--I--K--H--V--C--R--R--A--A--V--A--L--G--R--K--R--A--V--F--P--D--D--M--P--T--L--S--A--L--P--W--E--E-
GATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGCCGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAA
.::::::::::::::::::::::: :::::::::::::::::::::::::::::::::::::::::.:::::::::::::::::::::::.:::::::::
AATTAAACATGTCTGCAGAAGAGCTGCTGTTGCCCTTGGCCGAAAACGAGCTGTGTTTCCTGATGATATGCCCACCCTGAGTGCCTTACCGTGGGAAGAA
--I--K--H--V--C--R--R--A--A--V--A--L--G--R--K--R--A--V--F--P--D--D--M--P--T--L--S--A--L--P--W--E--E-

------------------------------------><--------------------------------------------------------------
-R--E--K--I--L--S--S--M--G--N--D--D--K--S--S--I--A--G--S--E--D--A--E--P--L--A--P--P--I--K--P--I--K--
CGAGAAAAGATTTTGTCTTCCATGGGGAATGATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAAC
::::::::.::::::::::::::::::::::::   ::::::::.:::::::::::::::::::::::::::::::::::.:::::::::::::::::::
CGAGAAAAAATTTTGTCTTCCATGGGGAATGAT---AAGTCATCGATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCGCCCATCAAACCAATTAAAC
-R--E--K--I--L--S--S--M--G--N--D-----K--S--S--I--A--G--S--E--D--A--E--P--L--A--P--P--I--K--P--I--K--

----------------------------------------------------------------------------------------------------
P--V--T--R--N--K--A--P--Q--E--P--P--V--K--K--G--R--R--S--R--R--C--G--Q--C--P--G--C--Q--V--P--E--D--C
CTGTCACTAGAAACAAGGCACCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTG
:::::::.::::::::::: :: :::::::::::.:::::::::::: : :::::.::::::::::::::::::::.:::::::::::::::::::::::
CTGTCACCAGAAACAAGGCTCCGCAGGAACCTCCGGTAAAGAAAGGAAGGCGATCAAGGCGGTGTGGGCAGTGTCCTGGCTGCCAGGTGCCTGAGGACTG
P--V--T--R--N--K--A--P--Q--E--P--P--V--K--K--G--R--R--S--R--R--C--G--Q--C--P--G--C--Q--V--P--E--D--C

-----------------------------------------------------------------------><---------------------------
--G--V--C--T--N--C--L--D--K--P--K--F--G--G--R--N--I--K--K--Q--C--C--K--M--R--K--C--Q--N--L--Q--W--M-
TGGTGTTTGTACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
:::::::::.::::::::..:.::.:::::::::::::::::.:::::.::::::::::::::::::   :::::::::::::::::::::::.::::::
TGGTGTTTGCACTAATTGTCTGGACAAGCCCAAGTTTGGTGGCCGCAACATAAAGAAGCAGTGCTGC---ATGAGAAAATGTCAGAATCTACAGTGGATG
--G--V--C--T--N--C--L--D--K--P--K--F--G--G--R--N--I--K--K--Q--C--C-----M--R--K--C--Q--N--L--Q--W--M-

------------------------------------><--------------------------------------------------------------
-P--S--K--A--Y--L--Q--K--Q--A--K--A--V--K--K--K--E--K--K--S--K--T--S--E--K--K--D--S--K--E--S--S--V--
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAGAGCAGTGTTG
::::::::: ::::::: ::.:::::::: :::   :::::::::::::::::::::::::::::.:::::::::::::: ::::::::::::::.::::
CCTTCCAAATCCTACCTTCAAAAGCAAGCAAAA---GTGAAAAAGAAAGAGAAAAAGTCTAAGACTAGTGAAAAGAAAGAGAGCAAAGAGAGCAGCGTTG
-P--S--K--S--Y--L--Q--K--Q--A--K-----V--K--K--K--E--K--K--S--K--T--S--E--K--K--E--S--K--E--S--S--V--

----------------------------------------------------------------------------------------------------
V--K--N--V--V--D--S--S--Q--K--P--T--P--S--A--R--E--D--P--A--P--K--K--S--S--S--E--P--P--P--R--K--P--V
TGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAGCCTCCTCCACGAAAGCCCGT
:::::::: ::::::::::::::::::::.:::::::: ::::::::::::::::..:::: ::::::::::..:::::.:::::::: :: ::::: ::
TGAAGAACTTGGTGGACTCTAGTCAGAAATCTACCCCAGCAGCAAGAGAGGATCCCACCCCCAAGAAAAGCAACAGTGAACCTCCTCCTCGCAAGCCGGT
V--K--N--L--V--D--S--S--Q--K--S--T--P--A--A--R--E--D--P--T--P--K--K--S--N--S--E--P--P--P--R--K--P--V

----------------------------------------------------------------------------------------------------
--E--E--K--S--E--E--G--N--V--S--A--P--G--P--E--S--K--Q--A--T--T--P--A--S--R--K--S--S--K--Q--V--S--Q-
CGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCTTCCAGGAAGTCAAGCAAGCAGGTCTCCCAG
 ::::: ::::::::.::::::::::.::: :::.: :  :::::. ::::.::::. .:..: :: .:.::::::::::: :.::::::::.:::::::
GGAGGACAAGAGTGAGGAAGGGAATGCCTCCGCCTCGGCCCCTGAGGCCAAGCAGGTGGCTGCACCCACCTCCAGGAAGTCCAACAAGCAGGCCTCCCAG
--E--D--K--S--E--E--G--N--A--S--A--S--A--P--E--A--K--Q--V--A--A--P--T--S--R--K--S--N--K--Q--A--S--Q-

----------------------------------------------------------------------------------------------------
-P--A--L--V--I--P--P--Q--P--P--T--T--G--P--P--R--K--E--V--P--K--T--T--P--S--E--P--K--K--K--Q--P--P--
CCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCCAAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCAC
:::.:::..:.:::::: :: ::::::::.: .:::: :::.::.:::::::::::::::::.:::::::::::::::::.:::::::::::::::::::
CCAACACCAGCCATCCCCCCACAGCCACCCAGCACAGCACCACCGAGAAAAGAAGTTCCCAAGACCACTCCTAGTGAGCCTAAGAAAAAGCAGCCTCCAC
-P--T--P--A--I--P--P--Q--P--P--S--T--A--P--P--R--K--E--V--P--K--T--T--P--S--E--P--K--K--K--Q--P--P--

--------------><------------------------------------------------------------------------><----------
P--P--E--S--G--P--E--Q--S--K--Q--K--K--V--A--P--R--P--S--I--P--V--K--Q--K--P--K--E--K--E--K--P--P--P
CACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGCCCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCC
: ::.::.      :::::.::.:::::.:::::::::::::::::.:::::::::::.:::::::::::::::::::::::::::::::::::::::::
CTCCGGAG------CCAGAACAAAGCAAGCAGAAAAAAGTGGCTCCTCGCCCAAGTATTCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCC
P--P--E--------P--E--Q--S--K--Q--K--K--V--A--P--R--P--S--I--P--V--K--Q--K--P--K--E--K--E--K--P--P--P

----------------------------------------------------------------------------------------------------
--V--N--K--Q--E--N--A--G--T--L--N--I--L--S--T--L--S--N--G--N--S--S--K--Q--K--I--P--A--D--G--V--H--R-
GGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTCAGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGG
.:::::::::::::::::.:::::::::::::::::::::::::::.:::::::::::::::::::.:::::::::::.:::::::::::::::::::::
AGTCAATAAGCAGGAGAACGCAGGCACTTTGAACATCCTCAGCACTTTCTCCAATGGCAATAGTTCCAAGCAAAAAATCCCAGCAGATGGAGTCCACAGG
--V--N--K--Q--E--N--A--G--T--L--N--I--L--S--T--F--S--N--G--N--S--S--K--Q--K--I--P--A--D--G--V--H--R-

--------------------><------------------------------------------------------------------------------
-I--R--V--D--F--K--E--D--C--E--A--E--N--V--W--E--M--G--G--L--G--I--L--T--S--V--P--I--T--P--R--V--V--
ATCAGAGTGGACTTTAAGGAGGATTGTGAAGCAGAAAATGTGTGGGAGATGGGAGGCTTAGGAATCTTGACTTCTGTTCCTATAACACCCAGGGTGGTTT
::::::::::::::::::::::::::::::::.::::::::::::::.:::::::::::::::::::::::.::::::::::::::::::::::::::::
ATCAGAGTGGACTTTAAGGAGGATTGTGAAGCGGAAAATGTGTGGGAAATGGGAGGCTTAGGAATCTTGACCTCTGTTCCTATAACACCCAGGGTGGTTT
-I--R--V--D--F--K--E--D--C--E--A--E--N--V--W--E--M--G--G--L--G--I--L--T--S--V--P--I--T--P--R--V--V--

----------------------------------><----------------------------------------------------------------
C--F--L--C--A--S--S--G--H--V--E--F--V--Y--C--Q--V--C--C--E--P--F--H--K--F--C--L--E--E--N--E--R--P--L
GCTTTCTCTGTGCCAGTAGTGGGCATGTAGAGTTTGTGTATTGCCAAGTCTGTTGTGAGCCCTTCCACAAGTTTTGTTTAGAGGAGAACGAGCGCCCTCT
::::::: ::::::::::::::::::::::::::::::::::::::::::::::::::.:::::::::::::::::::::::::::::::::::::::::
GCTTTCTGTGTGCCAGTAGTGGGCATGTAGAGTTTGTGTATTGCCAAGTCTGTTGTGAACCCTTCCACAAGTTTTGTTTAGAGGAGAACGAGCGCCCTCT
C--F--L--C--A--S--S--G--H--V--E--F--V--Y--C--Q--V--C--C--E--P--F--H--K--F--C--L--E--E--N--E--R--P--L

---------------------------------------------------------------------------------><-----------------
--E--D--Q--L--E--N--W--C--C--R--R--C--K--F--C--H--V--C--G--R--Q--H--Q--A--T--K--Q--L--L--E--C--N--K-
GGAGGACCAGCTGGAAAATTGGTGTTGTCGTCGTTGCAAATTCTGTCACGTTTGTGGAAGGCAACATCAGGCTACAAAGCAGCTGCTGGAGTGTAATAAG
:::::::::::::::::::::::::::::::::.:::::.::::::::.::::::::::::::.::::::::::::::::::::.:::::::::::::::
GGAGGACCAGCTGGAAAATTGGTGTTGTCGTCGCTGCAAGTTCTGTCATGTTTGTGGAAGGCAGCATCAGGCTACAAAGCAGCTACTGGAGTGTAATAAG
--E--D--Q--L--E--N--W--C--C--R--R--C--K--F--C--H--V--C--G--R--Q--H--Q--A--T--K--Q--L--L--E--C--N--K-

-----------------------------------------------------------------------------><---------------------
-C--R--N--S--Y--H--P--E--C--L--G--P--N--Y--P--T--K--P--T--K--K--K--K--V--W--I--C--T--K--C--V--R--C--
TGCCGAAACAGCTATCACCCTGAGTGCCTGGGACCAAACTACCCCACCAAACCCACAAAGAAGAAGAAAGTCTGGATCTGTACCAAGTGTGTTCGCTGTA
::::::::::::::::::::::::::::::::::::::::::::::::::::::.::::.                                        
TGCCGAAACAGCTATCACCCTGAGTGCCTGGGACCAAACTACCCCACCAAACCCGCAAAA----------------------------------------
-C--R--N--S--Y--H--P--E--C--L--G--P--N--Y--P--T--K--P--A--K-----------------------------------------

--------------------------------------------------------------------------------------------------><
K--S--C--G--S--T--T--P--G--K--G--W--D--A--Q--W--S--H--D--F--S--L--C--H--D--C--A--K--L--F--A--K--G--N
AGAGCTGTGGATCCACAACTCCAGGCAAAGGGTGGGATGCACAGTGGTCTCATGATTTCTCACTGTGTCATGATTGCGCCAAGCTCTTTGCTAAAGGAAA
                                                                                                  ::
--------------------------------------------------------------------------------------------------AA
---------------------------------------------------------------------------------------------------N

----------------------------------------------------------------------------------------------------
--F--C--P--L--C--D--K--C--Y--D--D--D--D--Y--E--S--K--M--M--Q--C--G--K--C--D--R--W--V--H--S--K--C--E-
CTTCTGCCCTCTCTGTGACAAATGTTATGATGATGATGACTATGAGAGTAAGATGATGCAATGTGGAAAGTGTGATCGCTGGGTCCATTCCAAATGTGAG
::::::::::::::::::.::.::::::::::::::::::::::::::::::::::::::.:::::.::.::.:::::::::::::::::::::::::::
CTTCTGCCCTCTCTGTGATAAGTGTTATGATGATGATGACTATGAGAGTAAGATGATGCAGTGTGGGAAATGCGATCGCTGGGTCCATTCCAAATGTGAG
--F--C--P--L--C--D--K--C--Y--D--D--D--D--Y--E--S--K--M--M--Q--C--G--K--C--D--R--W--V--H--S--K--C--E-

------------><--------------------------------------------------------------------------------------
-N--L--S--D--E--M--Y--E--I--L--S--N--L--P--E--S--V--A--Y--T--C--V--N--C--T--E--R--H--P--A--E--W--R--
AATCTTTCAGATGAGATGTATGAGATTCTATCTAATCTGCCAGAAAGTGTGGCCTACACTTGTGTGAACTGTACTGAGCGGCACCCTGCAGAGTGGCGAC
:::::::::                                                                                           
AATCTTTCA-------------------------------------------------------------------------------------------
-N--L--S--------------------------------------------------------------------------------------------

-------------------------------------------------------------------------------------------------><-
L--A--L--E--K--E--L--Q--I--S--L--K--Q--V--L--T--A--L--L--N--S--R--T--T--S--H--L--L--R--Y--R--Q--A--A
TGGCCCTTGAAAAAGAGCTGCAGATTTCTCTGAAGCAAGTTCTGACAGCTTTGTTGAATTCTCGGACTACCAGCCATTTGCTACGCTACCGGCAGGCTGC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--K--P--P--D--L--N--P--E--T--E--E--S--I--P--S--R--S--S--P--E--G--P--D--P--P--V--L--T--E--V--S--K--Q-
CAAGCCTCCAGACTTAAATCCCGAGACAGAGGAGAGTATACCTTCCCGCAGCTCCCCCGAAGGACCTGATCCACCAGTTCTTACTGAGGTCAGCAAACAG
                                                    ::.:: :::::::::::::::::::: :::::::::::::::::::::
----------------------------------------------------TCTCCAGAAGGACCTGATCCACCAGTGCTTACTGAGGTCAGCAAACAG
-----------------------------------------------------S--P--E--G--P--D--P--P--V--L--T--E--V--S--K--Q-

-----------------------------------------------------------------------><---------------------------
-D--D--Q--Q--P--L--D--L--E--G--V--K--R--K--M--D--Q--G--N--Y--T--S--V--L--E--F--S--D--D--I--V--K--I--
GATGATCAGCAGCCTTTAGATCTAGAAGGAGTCAAGAGGAAGATGGACCAAGGGAATTACACATCTGTGTTGGAGTTCAGTGATGATATTGTGAAGATCA
:: :::::.::::::::::::::.:::::::: ::::::::.::::::::::::::.::::::::::::                               
GAAGATCAACAGCCTTTAGATCTGGAAGGAGTGAAGAGGAAAATGGACCAAGGGAACTACACATCTGTG-------------------------------
-E--D--Q--Q--P--L--D--L--E--G--V--K--R--K--M--D--Q--G--N--Y--T--S--V--------------------------------

----------------------------------------------------------------------------------><----------------
I--Q--A--A--I--N--S--D--G--G--Q--P--E--I--K--K--A--N--S--M--V--K--S--F--F--I--R--Q--M--E--R--V--F--P
TTCAAGCAGCCATTAATTCAGATGGAGGACAGCCAGAAATTAAAAAAGCCAACAGCATGGTCAAGTCCTTCTTCATTCGGCAAATGGAACGTGTTTTTCC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

--------------------------------------------------------><------------------------------------------
--W--F--S--V--K--K--S--R--F--W--E--P--N--K--V--S--S--N--S--G--M--L--P--N--A--V--L--P--P--S--L--D--H-
ATGGTTCAGTGTCAAAAAGTCCAGGTTTTGGGAGCCAAATAAAGTATCAAGCAACAGTGGGATGTTACCAAACGCAGTGCTTCCACCTTCACTTGACCAT
                                                       :::::::::::::::::::::::::::::::::::::::::::::
-------------------------------------------------------AGTGGGATGTTACCAAACGCAGTGCTTCCACCTTCACTTGACCAT
--------------------------------------------------------S--G--M--L--P--N--A--V--L--P--P--S--L--D--H-

----------------------------------------------------------------------------------------------------
-N--Y--A--Q--W--Q--E--R--E--E--N--S--H--T--E--Q--P--P--L--M--K--K--I--I--P--A--P--K--P--K--G--P--G--
AATTATGCTCAGTGGCAGGAGCGAGAGGAAAACAGCCACACTGAGCAGCCTCCTTTAATGAAGAAAATCATTCCAGCTCCCAAACCCAAAGGTCCTGGAG
::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::.::::: :::::::
AATTATGCTCAGTGGCAGGAGCGAGAGGAAAACAGCCACACTGAGCAGCCTCCTTTAATGAAGAAAATCATTCCAGCTCCCAAACCTAAAGGGCCTGGAG
-N--Y--A--Q--W--Q--E--R--E--E--N--S--H--T--E--Q--P--P--L--M--K--K--I--I--P--A--P--K--P--K--G--P--G--

--------------------------------------------------><------------------------------------------------
E--P--D--S--P--T--P--L--H--P--P--T--P--P--I--L--S--T--D--R--S--R--E--D--S--P--E--L--N--P--P--P--G--I
AACCAGACTCACCAACTCCTCTGCATCCTCCTACACCACCAATTTTGAGTACTGATAGGAGTCGAGAAGACAGTCCAGAGCTGAACCCACCCCCAGGCAT
:::::::::::::::::::::::::::::::::::::::::::::::   ::::::::.:::::::::::.::::::::.::::::::::: ::::::::
AACCAGACTCACCAACTCCTCTGCATCCTCCTACACCACCAATTTTG---ACTGATAGAAGTCGAGAAGATAGTCCAGAACTGAACCCACCACCAGGCAT
E--P--D--S--P--T--P--L--H--P--P--T--P--P--I--L-----T--D--R--S--R--E--D--S--P--E--L--N--P--P--P--G--I

---------------------------------------------------------><-----------------------------------------
--E--D--N--R--Q--C--A--L--C--L--T--Y--G--D--D--S--A--N--D--A--G--R--L--L--Y--I--G--Q--N--E--W--T--H-
AGAAGACAATAGACAGTGTGCGTTATGTTTGACTTATGGTGATGACAGTGCTAATGATGCTGGTCGTTTACTATATATTGGCCAAAATGAGTGGACACAT
::::::.::::::::::::::.::.:::::::: ::::: ::.::::::::::::::::::::.:::::.:: ::.::::::::::::::::::::::::
AGAAGATAATAGACAGTGTGCATTGTGTTTGACGTATGGGGACGACAGTGCTAATGATGCTGGCCGTTTGCTCTACATTGGCCAAAATGAGTGGACACAT
--E--D--N--R--Q--C--A--L--C--L--T--Y--G--D--D--S--A--N--D--A--G--R--L--L--Y--I--G--Q--N--E--W--T--H-

-----------------------------------------------------------------------------------------------><---
-V--N--C--A--L--W--S--A--E--V--F--E--D--D--D--G--S--L--K--N--V--H--M--A--V--I--R--G--K--Q--L--R--C--
GTAAATTGTGCTTTGTGGTCAGCGGAAGTGTTTGAAGATGATGACGGATCACTAAAGAATGTGCATATGGCTGTGATCAGGGGCAAGCAGCTGAGATGTG
::::::::.::::::::::::::.::::::::::::::::::::.::::::::::::::::::::::::::::::::::::::::::::::::       
GTAAATTGCGCTTTGTGGTCAGCAGAAGTGTTTGAAGATGATGATGGATCACTAAAGAATGTGCATATGGCTGTGATCAGGGGCAAGCAGCTG-------
-V--N--C--A--L--W--S--A--E--V--F--E--D--D--D--G--S--L--K--N--V--H--M--A--V--I--R--G--K--Q--L--------

----------------------------------------------------------------------------------------------------
E--F--C--Q--K--P--G--A--T--V--G--C--C--L--T--S--C--T--S--N--Y--H--F--M--C--S--R--A--K--N--C--V--F--L
AATTCTGCCAAAAGCCAGGAGCCACCGTGGGTTGCTGTCTCACATCCTGCACCAGCAACTATCACTTCATGTGTTCCCGAGCCAAGAACTGTGTCTTTCT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

------------------------------------------------------><--------------------------------------------
--D--D--K--K--V--Y--C--Q--R--H--R--D--L--I--K--G--E--V--V--P--E--N--G--F--E--V--F--R--R--V--F--V--D-
GGATGATAAAAAAGTATATTGCCAACGACATCGGGATTTGATCAAAGGCGAAGTGGTTCCTGAGAATGGATTTGAAGTTTTCAGAAGAGTGTTTGTGGAC
                                                    :::::::::::::::::::::::::::::.::::::::::::::::::
----------------------------------------------------GTGGTTCCTGAGAATGGATTTGAAGTTTTTAGAAGAGTGTTTGTGGAC
-----------------------------------------------------V--V--P--E--N--G--F--E--V--F--R--R--V--F--V--D-

------------------------------------------------------------------------><--------------------------
-F--E--G--I--S--L--R--R--K--F--L--N--G--L--E--P--E--N--I--H--M--M--I--G--S--M--T--I--D--C--L--G--I--
TTTGAAGGAATCAGCTTGAGAAGGAAGTTTCTCAATGGCTTGGAACCAGAAAATATCCACATGATGATTGGGTCTATGACAATCGACTGCTTAGGAATTC
:::                                                                                                 
TTT-------------------------------------------------------------------------------------------------
-F--------------------------------------------------------------------------------------------------

---------------------------------------------------><-----------------------------------------------
L--N--D--L--S--D--C--E--D--K--L--F--P--I--G--Y--Q--C--S--R--V--Y--W--S--T--T--D--A--R--K--R--C--V--Y
TAAATGATCTCTCCGACTGTGAAGATAAGCTCTTTCCTATTGGATATCAGTGTTCCAGGGTATACTGGAGCACCACAGATGCTCGCAAGCGCTGTGTATA
                                                  ::::: :::::.:::::::::::::::::::::::::::::::::::.::
--------------------------------------------------TGTTCGAGGGTGTACTGGAGCACCACAGATGCTCGCAAGCGCTGTGTGTA
---------------------------------------------------C--S--R--V--Y--W--S--T--T--D--A--R--K--R--C--V--Y

----------------------------------------------------------------------------------------------------
--T--C--K--I--V--E--C--R--P--P--V--V--E--P--D--I--N--S--T--V--E--H--D--E--N--R--T--I--A--H--S--P--T-
TACATGCAAGATAGTGGAGTGCCGTCCTCCAGTCGTAGAGCCGGATATCAACAGCACTGTTGAACATGATGAAAACAGGACCATTGCCCATAGTCCAACA
.::.::::::::::: ::.::::::::::::::.::::::::.::.:::::::::::::::::::::::::::::.::.:::::.::.::.:::::: ::
CACGTGCAAGATAGTCGAATGCCGTCCTCCAGTTGTAGAGCCAGACATCAACAGCACTGTTGAACATGATGAAAATAGAACCATCGCTCACAGTCCATCA
--T--C--K--I--V--E--C--R--P--P--V--V--E--P--D--I--N--S--T--V--E--H--D--E--N--R--T--I--A--H--S--P--S-

------------><--------------------------------------------------------------------------------------
-S--F--T--E--S--S--S--K--E--S--Q--N--T--A--E--I--I--S--P--P--S--P--D--R--P--P--H--S--Q--T--S--G--S--
TCTTTTACAGAAAGTTCATCAAAAGAGAGTCAAAACACAGCTGAAATTATAAGTCCTCCATCACCAGACCGACCTCCTCATTCACAAACCTCTGGCTCCT
::::::      : :::::: ::.::::::::::::::::::::::::.:::::::::::::::::::::::::::::::::::::.::::: ::.::::
TCTTTT------ATTTCATCTAAGGAGAGTCAAAACACAGCTGAAATTGTAAGTCCTCCATCACCAGACCGACCTCCTCATTCACAGACCTCGGGTTCCT
-S--F--------I--S--S--K--E--S--Q--N--T--A--E--I--V--S--P--P--S--P--D--R--P--P--H--S--Q--T--S--G--S--

--------------------------------------------------------------------------------------------------><
C--Y--Y--H--V--I--S--K--V--P--R--I--R--T--P--S--Y--S--P--T--Q--R--S--P--G--C--R--P--L--P--S--A--G--S
GTTATTATCATGTCATCTCAAAGGTCCCCAGGATTCGAACACCCAGTTATTCTCCAACACAGAGATCCCCTGGCTGTCGACCGTTGCCTTCTGCAGGAAG
::: ::::::::::::::::::::::::.::::::::::::::::::::.::::::::.::::::::::::::::::::.::..:::::::::::   ::
GTTTTTATCATGTCATCTCAAAGGTCCCTAGGATTCGAACACCCAGTTACTCTCCAACGCAGAGATCCCCTGGCTGTCGGCCACTGCCTTCTGCA---AG
C--F--Y--H--V--I--S--K--V--P--R--I--R--T--P--S--Y--S--P--T--Q--R--S--P--G--C--R--P--L--P--S--A-----S

----------------------------------------------------------------------------------------------------
--P--T--P--T--T--H--E--I--V--T--V--G--D--P--L--L--S--S--G--L--R--S--I--G--S--R--R--H--S--T--S--S--L-
TCCTACCCCAACCACTCATGAAATAGTCACAGTAGGTGATCCTTTACTCTCCTCTGGACTTCGAAGCATTGGCTCCAGGCGTCACAGTACCTCTTCCTTA
.:::::::::::.::.:::::::::::::::::.:::::.::::::::::::::::::::::::::::::::::::::::::::::::::::::::.::.
CCCTACCCCAACTACCCATGAAATAGTCACAGTGGGTGACCCTTTACTCTCCTCTGGACTTCGAAGCATTGGCTCCAGGCGTCACAGTACCTCTTCTTTG
--P--T--P--T--T--H--E--I--V--T--V--G--D--P--L--L--S--S--G--L--R--S--I--G--S--R--R--H--S--T--S--S--L-

----------------------------------------------------------------------------------------------------
-S--P--Q--R--S--K--L--R--I--M--S--P--M--R--T--G--N--T--Y--S--R--N--N--V--S--S--V--S--T--T--G--T--A--
TCACCCCAGCGGTCCAAACTCCGGATAATGTCTCCAATGAGAACTGGGAATACTTACTCTAGGAATAATGTTTCCTCAGTCTCCACCACCGGGACCGCTA
::::::::: :::: ::.:::::::::::::::::::::::.::::::..:::::::::.:::::::..::::::::: :::::::::. ::::::.:::
TCACCCCAGAGGTCGAAGCTCCGGATAATGTCTCCAATGAGGACTGGGGGTACTTACTCCAGGAATAGCGTTTCCTCACTCTCCACCATAGGGACCACTA
-S--P--Q--R--S--K--L--R--I--M--S--P--M--R--T--G--G--T--Y--S--R--N--S--V--S--S--L--S--T--I--G--T--T--

----------------------------------------------------------------------------------------------------
T--D--L--E--S--S--A--K--V--V--D--H--V--L--G--P--L--N--S--S--T--S--L--G--Q--N--T--S--T--S--S--N--L--Q
CTGATCTTGAATCAAGTGCCAAAGTAGTTGATCATGTCTTAGGGCCACTGAATTCAAGTACTAGTTTAGGGCAAAACACTTCCACCTCTTCAAATTTGCA
:.::::::::.:::::::::::::.::.:::::::::::::::::::::::::::::.:::::.::::::::::::::::.:::::::::::::::::::
CCGATCTTGAGTCAAGTGCCAAAGCAGCTGATCATGTCTTAGGGCCACTGAATTCAAATACTAATTTAGGGCAAAACACTCCCACCTCTTCAAATTTGCA
T--D--L--E--S--S--A--K--A--A--D--H--V--L--G--P--L--N--S--N--T--N--L--G--Q--N--T--P--T--S--S--N--L--Q

----------------------------------------------------------------------------------------------------
--R--T--V--V--T--V--G--N--K--N--S--H--L--D--G--S--S--S--S--E--M--K--Q--S--S--A--S--D--L--V--S--K--S-
AAGGACAGTGGTTACTGTAGGCAATAAAAACAGTCACTTGGATGGATCTTCATCTTCAGAAATGAAGCAGTCCAGTGCTTCAGACTTGGTGTCCAAGAGC
:::::::::::::::: :.:::: ::::: ::::::::::::.:: .::::.::::::::.:::::::: ::.:::::.:::::::.:.. :::::::::
AAGGACAGTGGTTACTCTGGGCACTAAAACCAGTCACTTGGACGGCCCTTCGTCTTCAGAGATGAAGCACTCTAGTGCCTCAGACTCGACCTCCAAGAGC
--R--T--V--V--T--L--G--T--K--T--S--H--L--D--G--P--S--S--S--E--M--K--H--S--S--A--S--D--S--T--S--K--S-

----------------------------------------------------------------------------------------------------
-S--S--L--K--G--E--K--T--K--V--L--S--S--K--S--S--E--G--S--A--H--N--V--A--Y--P--G--I--P--K--L--A--P--
TCCTCTTTAAAGGGAGAGAAGACCAAAGTGCTGAGTTCCAAGAGCTCAGAGGGATCTGCACATAATGTGGCTTACCCTGGAATTCCTAAACTGGCCCCAC
::::::::.::::::::.:::::::::.:::.:::::::::::.:::.:::::.:::::::::::.:::::::::::::: ::::: :::::::::::::
TCCTCTTTGAAGGGAGAAAAGACCAAAATGCCGAGTTCCAAGAACTCGGAGGGGTCTGCACATAACGTGGCTTACCCTGGCATTCCGAAACTGGCCCCAC
-S--S--L--K--G--E--K--T--K--M--P--S--S--K--N--S--E--G--S--A--H--N--V--A--Y--P--G--I--P--K--L--A--P--

----------------------------------------------------------------------------------------------------
Q--V--H--N--T--T--S--R--E--L--N--V--S--K--I--G--S--F--A--E--P--S--S--V--S--F--S--S--K--E--A--L--S--F
AGGTTCATAACACAACATCTAGAGAACTGAATGTTAGTAAAATCGGCTCCTTTGCTGAACCCTCTTCAGTGTCGTTTTCTTCTAAAGAGGCCCTCTCCTT
::::::::::.:::::::::.:::::.::::.::::::::::: ::: :.::.:::::::.::::::::::.:.:::::::::::::::::::::.: ::
AGGTTCATAATACAACATCTGGAGAATTGAACGTTAGTAAAATGGGCACTTTCGCTGAACTCTCTTCAGTGCCATTTTCTTCTAAAGAGGCCCTCCCGTT
Q--V--H--N--T--T--S--G--E--L--N--V--S--K--M--G--T--F--A--E--L--S--S--V--P--F--S--S--K--E--A--L--P--F

----------------------------------------------------------------------------------------------------
--P--H--L--H--L--R--G--Q--R--N--D--R--D--Q--H--T--D--S--T--Q--S--A--N--S--S--P--D--E--D--T--E--V--K-
CCCACACCTCCATTTGAGAGGGCAAAGGAATGATCGAGACCAACACACAGATTCTACCCAATCAGCAAACTCCTCTCCAGATGAAGATACTGAAGTCAAA
:::::  :::::::::::::::::::::::.::::::::::::::  ::::::::: :::.:..::::::.:..:::: :::::::::::::::::::::
CCCACCACTCCATTTGAGAGGGCAAAGGAACGATCGAGACCAACAGCCAGATTCTAACCAGTTGGCAAACCCTCCTCCCGATGAAGATACTGAAGTCAAA
--P--P--L--H--L--R--G--Q--R--N--D--R--D--Q--Q--P--D--S--N--Q--L--A--N--P--P--P--D--E--D--T--E--V--K-

----------------------------------------------------------------------------------------------------
-T--L--K--L--S--G--M--S--N--R--S--S--I--I--N--E--H--M--G--S--S--S--R--D--R--R--Q--K--G--K--K--S--C--
ACCTTGAAGCTATCTGGAATGAGCAACAGATCATCCATTATCAACGAACATATGGGATCTAGTTCCAGAGATAGGAGACAGAAAGGGAAAAAATCCTGTA
::.::::::.:.::::::.::::::.:::: :.::::.:::::..:::::..:::::::::::::::::::.:::::::::::::::::::::::. :::
ACTTTGAAGTTGTCTGGAGTGAGCAGCAGAGCGTCCACTATCAGTGAACACGTGGGATCTAGTTCCAGAGACAGGAGACAGAAAGGGAAAAAATCTGGTA
-T--L--K--L--S--G--V--S--S--R--A--S--T--I--S--E--H--V--G--S--S--S--R--D--R--R--Q--K--G--K--K--S--G--

----------------------------------------------------------------------------------------------------
K--E--T--F--K--E--K--H--S--S--K--S--F--L--E--P--G--Q--V--T--T--G--E--E--G--N--L--K--P--E--F--M--D--E
AAGAAACTTTCAAAGAAAAGCATTCCAGTAAATCTTTTTTGGAACCTGGTCAGGTGACAACTGGTGAGGAAGGAAACTTGAAGCCAGAGTTTATGGATGA
:::: ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::.:.:::::::::::.::::::::
AAGACACTTTCAAAGAAAAGCATTCCAGTAAATCTTTTTTGGAACCTGGTCAGGTGACAACTGGTGAGGAAGGAAACCTAAAGCCAGAGTTCATGGATGA
K--D--T--F--K--E--K--H--S--S--K--S--F--L--E--P--G--Q--V--T--T--G--E--E--G--N--L--K--P--E--F--M--D--E

----------------------------------------------------------------------------------------------------
--V--L--T--P--E--Y--M--G--Q--R--P--C--N--N--V--S--S--D--K--I--G--D--K--G--L--S--M--P--G--V--P--K--A-
GGTTTTGACTCCTGAGTATATGGGCCAACGACCATGTAACAATGTTTCTTCTGATAAGATTGGTGATAAAGGCCTTTCTATGCCAGGAGTCCCCAAAGCT
.:::::::::::::::: .::::: ::::::::::::::.::::::::::::::::::::::: ::.:::: :: ::::::  :::::::::::::::::
AGTTTTGACTCCTGAGTTCATGGGGCAACGACCATGTAATAATGTTTCTTCTGATAAGATTGGGGACAAAGTCCATTCTATTGCAGGAGTCCCCAAAGCT
--V--L--T--P--E--F--M--G--Q--R--P--C--N--N--V--S--S--D--K--I--G--D--K--V--H--S--I--A--G--V--P--K--A-

----------------------------------------------------------------------------------------------------
-P--P--M--Q--V--E--G--S--A--K--E--L--Q--A--P--R--K--R--T--V--K--V--T--L--T--P--L--K--M--E--N--E--S--
CCACCCATGCAAGTAGAAGGATCTGCCAAGGAATTACAGGCACCACGGAAACGCACAGTCAAAGTGACACTGACACCTCTAAAAATGGAAAATGAGAGTC
 ::.::::::::::::::::.::::::::::::::::::.:::: ::::::::::::::::::::.:::::::::::::::::::::::.:..:::::::
GCATCCATGCAAGTAGAAGGGTCTGCCAAGGAATTACAGACACCCCGGAAACGCACAGTCAAAGTAACACTGACACCTCTAAAAATGGAGAGCGAGAGTC
-A--S--M--Q--V--E--G--S--A--K--E--L--Q--T--P--R--K--R--T--V--K--V--T--L--T--P--L--K--M--E--S--E--S--

----------------------------------------------------------------------------------------------------
Q--S--K--N--A--L--K--E--S--S--P--A--S--P--L--Q--I--E--S--T--S--P--T--E--P--I--S--A--S--E--N--P--G--D
AATCCAAAAATGCCCTGAAAGAAAGTAGTCCTGCTTCCCCTTTGCAAATAGAGTCAACATCTCCCACAGAACCAATTTCAGCCTCTGAAAATCCAGGAGA
:.:::::.:::.:::::::::::::::::::::.:::::::.::::.::::::.::.::::::: :::::::::.:.:::::::::::::.:::::::::
AGTCCAAGAATACCCTGAAAGAAAGTAGTCCTGTTTCCCCTCTGCAGATAGAGCCAGCATCTCCGACAGAACCAGTCTCAGCCTCTGAAAGTCCAGGAGA
Q--S--K--N--T--L--K--E--S--S--P--V--S--P--L--Q--I--E--P--A--S--P--T--E--P--V--S--A--S--E--S--P--G--D

----------------------------------------------------------------------------------------------------
--G--P--V--A--Q--P--S--P--N--N--T--S--C--Q--D--S--Q--S--N--N--Y--Q--N--L--P--V--Q--D--R--N--L--M--L-
TGGTCCAGTGGCCCAACCAAGCCCCAATAATACCTCATGCCAGGATTCTCAAAGTAACAACTATCAGAATCTTCCAGTACAGGACAGAAACCTAATGCTT
:::::::::.:::::.:::::::::::::::::::: : ::::::::::::::::::::.::::::::::::::::::::::::::::::::::::::::
TGGTCCAGTAGCCCAGCCAAGCCCCAATAATACCTCCTCCCAGGATTCTCAAAGTAACAGCTATCAGAATCTTCCAGTACAGGACAGAAACCTAATGCTT
--G--P--V--A--Q--P--S--P--N--N--T--S--S--Q--D--S--Q--S--N--S--Y--Q--N--L--P--V--Q--D--R--N--L--M--L-

----------------------------------------------------------------------------------------------------
-P--D--G--P--K--P--Q--E--D--G--S--F--K--R--R--Y--P--R--R--S--A--R--A--R--S--N--M--F--F--G--L--T--P--
CCAGATGGCCCCAAACCTCAGGAGGATGGCTCTTTTAAAAGGAGGTATCCCCGTCGCAGTGCCCGTGCACGTTCTAACATGTTTTTTGGGCTTACCCCAC
:::::::: ::::::::::::::::::::::::::.::.:::::::::                                                    
CCAGATGGGCCCAAACCTCAGGAGGATGGCTCTTTCAAGAGGAGGTAT----------------------------------------------------
-P--D--G--P--K--P--Q--E--D--G--S--F--K--R--R--Y-----------------------------------------------------

----------------------------------------------------------------------------------------------------
L--Y--G--V--R--S--Y--G--E--E--D--I--P--F--Y--S--S--S--T--G--K--K--R--G--K--R--S--A--E--G--Q--V--D--G
TCTATGGAGTAAGATCCTATGGTGAAGAAGACATTCCATTCTACAGCAGCTCAACTGGGAAGAAGCGAGGCAAGAGATCAGCTGAAGGACAGGTGGATGG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--A--D--D--L--S--T--S--D--E--D--D--L--Y--Y--Y--N--F--T--R--T--V--I--S--S--G--G--E--E--R--L--A--S--H-
GGCCGATGACTTAAGCACTTCAGATGAAGACGACTTATACTATTACAACTTCACTAGAACAGTGATTTCTTCAGGTGGAGAGGAACGACTGGCATCCCAT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-N--L--F--R--E--E--E--Q--C--D--L--P--K--I--S--Q--L--D--G--V--D--D--G--T--E--S--D--T--S--V--T--A--T--
AATTTATTTCGGGAGGAGGAACAGTGTGATCTTCCAAAAATCTCACAGTTGGATGGTGTTGATGATGGGACAGAGAGTGATACTAGTGTCACAGCCACAA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
T--R--K--S--S--Q--I--P--K--R--N--G--K--E--N--G--T--E--N--L--K--I--D--R--P--E--D--A--G--E--K--E--H--V
CAAGGAAAAGCAGCCAGATTCCAAAAAGAAATGGTAAAGAAAATGGAACAGAGAACTTAAAGATTGATAGACCTGAAGATGCTGGGGAGAAAGAACATGT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--T--K--S--S--V--G--H--K--N--E--P--K--M--D--N--C--H--S--V--S--R--V--K--T--Q--G--Q--D--S--L--E--A--Q-
CACTAAGAGTTCTGTTGGCCACAAAAATGAGCCAAAGATGGATAACTGCCATTCTGTAAGCAGAGTTAAAACACAGGGACAAGATTCCTTGGAAGCTCAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-L--S--S--L--E--S--S--R--R--V--H--T--S--T--P--S--D--K--N--L--L--D--T--Y--N--T--E--L--L--K--S--D--S--
CTCAGCTCATTGGAGTCAAGCCGCAGAGTCCACACAAGTACCCCCTCCGACAAAAATTTACTGGACACCTATAATACTGAGCTCCTGAAATCAGATTCAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
D--N--N--N--S--D--D--C--G--N--I--L--P--S--D--I--M--D--F--V--L--K--N--T--P--S--M--Q--A--L--G--E--S--P
ACAATAACAACAGTGATGACTGTGGGAATATCCTGCCTTCAGACATTATGGACTTTGTACTAAAGAATACTCCATCCATGCAGGCTTTGGGTGAGAGCCC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--E--S--S--S--S--E--L--L--N--L--G--E--G--L--G--L--D--S--N--R--E--K--D--M--G--L--F--E--V--F--S--Q--Q-
AGAGTCATCTTCATCAGAACTCCTGAATCTTGGTGAAGGATTGGGTCTTGACAGTAATCGTGAAAAAGACATGGGTCTTTTTGAAGTATTTTCTCAGCAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-L--P--T--T--E--P--V--D--S--S--V--S--S--S--I--S--A--E--E--Q--F--E--L--P--L--E--L--P--S--D--L--S--V--
CTGCCTACAACAGAACCTGTGGATAGTAGTGTCTCTTCCTCTATCTCAGCAGAGGAACAGTTTGAGTTGCCTCTAGAGCTACCATCTGATCTGTCTGTCT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
L--T--T--R--S--P--T--V--P--S--Q--N--P--S--R--L--A--V--I--S--D--S--G--E--K--R--V--T--I--T--E--K--S--V
TGACCACCCGGAGTCCCACTGTCCCCAGCCAGAATCCCAGTAGACTAGCTGTTATCTCAGACTCAGGGGAGAAGAGAGTAACCATCACAGAAAAATCTGT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--A--S--S--E--S--D--P--A--L--L--S--P--G--V--D--P--T--P--E--G--H--M--T--P--D--H--F--I--Q--G--H--M--D-
AGCCTCCTCTGAAAGTGACCCAGCACTGCTGAGCCCAGGAGTAGATCCAACTCCTGAAGGCCACATGACTCCTGATCATTTTATCCAAGGACACATGGAT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-A--D--H--I--S--S--P--P--C--G--S--V--E--Q--G--H--G--N--N--Q--D--L--T--R--N--S--S--T--P--G--L--Q--V--
GCAGACCACATCTCTAGCCCTCCTTGTGGTTCAGTAGAGCAAGGTCATGGCAACAATCAGGATTTAACTAGGAACAGTAGCACCCCTGGCCTTCAGGTAC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
P--V--S--P--T--V--P--I--Q--N--Q--K--Y--V--P--N--S--T--D--S--P--G--P--S--Q--I--S--N--A--A--V--Q--T--T
CTGTTTCCCCAACTGTTCCCATCCAGAACCAGAAGTATGTGCCCAATTCTACTGATAGTCCTGGCCCGTCTCAGATTTCCAATGCAGCTGTCCAGACCAC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--P--P--H--L--K--P--A--T--E--K--L--I--V--V--N--Q--N--M--Q--P--L--Y--V--L--Q--T--L--P--N--G--V--T--Q-
TCCACCCCACCTGAAGCCAGCCACTGAGAAACTCATAGTTGTTAACCAGAACATGCAGCCACTTTATGTTCTCCAAACTCTTCCAAATGGAGTGACCCAA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-K--I--Q--L--T--S--S--V--S--S--T--P--S--V--M--E--T--N--T--S--V--L--G--P--M--G--G--G--L--T--L--T--T--
AAAATCCAATTGACCTCTTCTGTTAGTTCTACACCCAGTGTGATGGAGACAAATACTTCAGTATTGGGACCCATGGGAGGTGGTCTCACCCTTACCACAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
G--L--N--P--S--L--P--T--S--Q--S--L--F--P--S--A--S--K--G--L--L--P--M--S--H--H--Q--H--L--H--S--F--P--A
GACTAAATCCAAGCTTGCCAACTTCTCAATCTTTGTTCCCTTCTGCTAGCAAAGGATTGCTACCCATGTCTCATCACCAGCACTTACATTCCTTCCCTGC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--A--T--Q--S--S--F--P--P--N--I--S--N--P--P--S--G--L--L--I--G--V--Q--P--P--P--D--P--Q--L--L--V--S--E-
AGCTACTCAAAGTAGTTTCCCACCAAACATCAGCAATCCTCCTTCAGGCCTGCTTATTGGGGTTCAGCCTCCTCCGGATCCCCAACTTTTGGTTTCAGAA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-S--S--Q--R--T--D--L--S--T--T--V--A--T--P--S--S--G--L--K--K--R--P--I--S--R--L--Q--T--R--K--N--K--K--
TCCAGCCAGAGGACAGACCTCAGTACCACAGTAGCCACTCCATCCTCTGGACTCAAGAAAAGACCCATATCTCGTCTACAGACCCGAAAGAATAAAAAAC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
L--A--P--S--S--T--P--S--N--I--A--P--S--D--V--V--S--N--M--T--L--I--N--F--T--P--S--Q--L--P--N--H--P--S
TTGCTCCCTCTAGTACCCCTTCAAACATTGCCCCTTCTGATGTGGTTTCTAATATGACATTGATTAACTTCACACCCTCCCAGCTTCCTAATCATCCAAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--L--L--D--L--G--S--L--N--T--S--S--H--R--T--V--P--N--I--I--K--R--S--K--S--S--I--M--Y--F--E--P--A--P-
TCTGTTAGATTTGGGGTCACTTAATACTTCATCTCACCGAACTGTCCCCAACATCATAAAAAGATCTAAATCTAGCATCATGTATTTTGAACCGGCACCC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-L--L--P--Q--S--V--G--G--T--A--A--T--A--A--G--T--S--T--I--S--Q--D--T--S--H--L--T--S--G--S--V--S--G--
CTGTTACCACAGAGTGTGGGAGGAACTGCTGCCACAGCGGCAGGCACATCAACAATAAGCCAGGATACTAGCCACCTCACATCAGGGTCTGTGTCTGGCT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
L--A--S--S--S--S--V--L--N--V--V--S--M--Q--T--T--T--T--P--T--S--S--A--S--V--P--G--H--V--T--L--T--N--P
TGGCATCCAGTTCCTCTGTCTTGAATGTTGTATCCATGCAAACTACCACAACCCCTACAAGTAGTGCGTCAGTTCCAGGACACGTCACCTTAACCAACCC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--R--L--L--G--T--P--D--I--G--S--I--S--N--L--L--I--K--A--S--Q--Q--S--L--G--I--Q--D--Q--P--V--A--L--P-
AAGGTTGCTTGGTACCCCAGATATTGGCTCAATAAGCAATCTTTTAATCAAAGCTAGCCAGCAGAGCCTGGGGATTCAGGACCAGCCTGTGGCTTTACCG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-P--S--S--G--M--F--P--Q--L--G--T--S--Q--T--P--S--T--A--A--I--T--A--A--S--S--I--C--V--L--P--S--T--Q--
CCAAGTTCAGGAATGTTTCCACAACTGGGGACATCACAGACCCCCTCTACTGCTGCAATAACAGCGGCATCTAGCATCTGTGTGCTCCCCTCCACTCAGA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
T--T--G--I--T--A--A--S--P--S--G--E--A--D--E--H--Y--Q--L--Q--H--V--N--Q--L--L--A--S--K--T--G--I--H--S
CTACGGGCATAACAGCCGCTTCACCTTCTGGGGAAGCAGACGAACACTATCAGCTTCAGCATGTGAACCAGCTCCTTGCCAGCAAAACTGGGATTCATTC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--S--Q--R--D--L--D--S--A--S--G--P--Q--V--S--N--F--T--Q--T--V--D--A--P--N--S--M--G--L--E--Q--N--K--A-
TTCCCAGCGTGATCTTGATTCTGCTTCAGGGCCCCAGGTATCCAACTTTACCCAGACGGTAGACGCTCCTAATAGCATGGGACTGGAGCAGAACAAGGCT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-L--S--S--A--V--Q--A--S--P--T--S--P--G--G--S--P--S--S--P--S--S--G--Q--R--S--A--S--P--S--V--P--G--P--
TTATCCTCAGCTGTGCAAGCCAGCCCCACCTCTCCTGGGGGTTCTCCATCCTCTCCATCTTCTGGACAGCGGTCAGCAAGCCCTTCAGTGCCGGGTCCCA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
T--K--P--K--P--K--T--K--R--F--Q--L--P--L--D--K--G--N--G--K--K--H--K--V--S--H--L--R--T--S--S--S--E--A
CTAAACCCAAACCAAAAACCAAACGGTTTCAGCTGCCTCTAGACAAAGGGAATGGCAAGAAGCACAAAGTTTCCCATTTGCGGACCAGTTCTTCTGAAGC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-----------------------------------------------><---------------------------------------------------
--H--I--P--D--Q--E--T--T--S--L--T--S--G--T--G--T--P--G--A--E--A--E--Q--Q--D--T--A--S--V--E--Q--S--S-
ACACATTCCAGACCAAGAAACGACATCCCTGACCTCAGGCACAGGGACTCCAGGAGCAGAGGCTGAGCAGCAGGATACAGCTAGCGTGGAGCAGTCCTCC
                                              ::::::::::::::::::::::::::.:: ::::::::.::::::::::: :: 
----------------------------------------------ACTCCAGGAGCAGAGGCTGAGCAGCAAGAAACAGCTAGTGTGGAGCAGTCATCA
-----------------------------------------------T--P--G--A--E--A--E--Q--Q--E--T--A--S--V--E--Q--S--S-

----------------------------><---------------------------------------------------------------><-----
-Q--K--E--C--G--Q--P--A--G--Q--V--A--V--L--P--E--V--Q--V--T--Q--N--P--A--N--E--Q--E--S--A--E--P--K--
CAGAAGGAGTGTGGGCAACCTGCAGGGCAAGTCGCTGTTCTTCCGGAAGTTCAGGTGACCCAAAATCCAGCAAATGAACAAGAAAGTGCAGAACCTAAAA
:::::::..::::::::.::::::                                                                     :::::::
CAGAAGGGATGTGGGCAGCCTGCA---------------------------------------------------------------------CCTAAAA
-Q--K--G--C--G--Q--P--A-----------------------------------------------------------------------P--K--

----------------------------------------------------------------------------------------------------
T--V--E--E--E--E--S--N--F--S--S--P--L--M--L--W--L--Q--Q--E--Q--K--R--K--E--S--I--T--E--K--K--P--K--K
CAGTGGAAGAAGAGGAAAGTAATTTCAGCTCCCCACTGATGCTTTGGCTTCAGCAAGAACAAAAGCGGAAGGAAAGCATTACTGAGAAAAAACCCAAGAA
:::..::::::::.:::::::::::::::::.:::::::::::: ::::.:::::::::::.::::::::::::::::::.::::::::::.::::::::
CAGCAGAAGAAGAAGAAAGTAATTTCAGCTCTCCACTGATGCTTGGGCTCCAGCAAGAACAGAAGCGGAAGGAAAGCATTGCTGAGAAAAAGCCCAAGAA
T--A--E--E--E--E--S--N--F--S--S--P--L--M--L--G--L--Q--Q--E--Q--K--R--K--E--S--I--A--E--K--K--P--K--K

----------------------------------------------------------------><----------------------------------
--G--L--V--F--E--I--S--S--D--D--G--F--Q--I--C--A--E--S--I--E--D--A--W--K--S--L--T--D--K--V--Q--E--A-
AGGACTTGTTTTTGAAATTTCCAGTGATGATGGCTTTCAGATCTGTGCAGAAAGTATTGAAGATGCCTGGAAGTCATTGACAGATAAAGTCCAGGAAGCT
::: ::::::::::::::::: ::::::::::::::::::::::::::.::::::::::::   ::::::::.:::::::::::::::::::::::::::
AGGTCTTGTTTTTGAAATTTCAAGTGATGATGGCTTTCAGATCTGTGCGGAAAGTATTGAA---GCCTGGAAATCATTGACAGATAAAGTCCAGGAAGCT
--G--L--V--F--E--I--S--S--D--D--G--F--Q--I--C--A--E--S--I--E-----A--W--K--S--L--T--D--K--V--Q--E--A-

---------------------------------------><-----------------------------------------------------------
-R--S--N--A--R--L--K--Q--L--S--F--A--G--V--N--G--L--R--M--L--G--I--L--H--D--A--V--V--F--L--I--E--Q--
CGATCAAATGCCCGCCTAAAGCAGCTCTCATTTGCAGGTGTTAACGGTTTGAGGATGCTGGGGATTCTCCATGATGCAGTTGTGTTCCTCATTGAGCAGC
::.:::::::::::::::::::::::.:::::::::   :: ::.::::::::::::::::::::::::::::::::.::::::::::: ::::::::::
CGGTCAAATGCCCGCCTAAAGCAGCTTTCATTTGCA---GTGAATGGTTTGAGGATGCTGGGGATTCTCCATGATGCGGTTGTGTTCCTGATTGAGCAGC
-R--S--N--A--R--L--K--Q--L--S--F--A-----V--N--G--L--R--M--L--G--I--L--H--D--A--V--V--F--L--I--E--Q--

----------------------------------------------------------------------------------------------------
L--S--G--A--K--H--C--R--N--Y--K--F--R--F--H--K--P--E--E--A--N--E--P--P--L--N--P--H--G--S--A--R--A--E
TGTCTGGTGCCAAGCACTGTCGAAATTACAAATTCCGTTTCCACAAGCCAGAGGAGGCCAATGAACCCCCCTTGAACCCTCACGGCTCAGCCAGGGCTGA
:::::::::::::::::::: :.::::::::::::::::::::::::::::::::::::::::::::::::.::::::::::.:::::::::::::::::
TGTCTGGTGCCAAGCACTGTAGGAATTACAAATTCCGTTTCCACAAGCCAGAGGAGGCCAATGAACCCCCCCTGAACCCTCATGGCTCAGCCAGGGCTGA
L--S--G--A--K--H--C--R--N--Y--K--F--R--F--H--K--P--E--E--A--N--E--P--P--L--N--P--H--G--S--A--R--A--E

------------------><--------------------------------------------------------------------------------
--V--H--L--R--Q--S--A--F--D--M--F--N--F--L--A--S--K--H--R--Q--P--P--E--Y--N--P--N--D--E--E--E--E--E-
AGTCCACCTCAGGCAATCAGCATTTGACATGTTTAACTTCCTGGCTTCTAAACATCGTCAGCCTCCTGAATACAACCCCAATGATGAAGAAGAGGAGGAG
.:::::::: :::   ::::::::::::::::::::::::::::::::::::::::: ::::::::::::                              
GGTCCACCTGAGG---TCAGCATTTGACATGTTTAACTTCCTGGCTTCTAAACATCGGCAGCCTCCTGAA------------------------------
--V--H--L--R-----S--A--F--D--M--F--N--F--L--A--S--K--H--R--Q--P--P--E-------------------------------

----------------------><----------------------------------------------------------------------------
-V--Q--L--K--S--A--R--R--A--T--S--M--D--L--P--M--P--M--R--F--R--H--L--K--K--T--S--K--E--A--V--G--V--
GTACAGCTGAAGTCAGCTCGGAGGGCAACTAGCATGGATCTGCCAATGCCCATGCGCTTCCGGCACTTAAAAAAGACTTCTAAGGAGGCAGTTGGTGTCT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

------><--------------------------------------------------------------------------------------------
Y--R--S--P--I--H--G--R--G--L--F--C--K--R--N--I--D--A--G--E--M--V--I--E--Y--A--G--N--V--I--R--S--I--Q
ACAGGTCTCCCATCCATGGCCGGGGTCTTTTCTGTAAGAGAAACATTGATGCAGGTGAGATGGTGATTGAGTATGCCGGCAACGTCATCCGCTCCATCCA
     :::::::::::.::::::::::::::.:::::.:::::::::::.::.::::::::::::::::::::.::::::::.::::::::.::::::::
-----TCTCCCATCCACGGCCGGGGTCTTTTTTGTAAAAGAAACATTGACGCGGGTGAGATGGTGATTGAGTACGCCGGCAATGTCATCCGTTCCATCCA
------S--P--I--H--G--R--G--L--F--C--K--R--N--I--D--A--G--E--M--V--I--E--Y--A--G--N--V--I--R--S--I--Q

------------------------------------><--------------------------------------------------------------
--T--D--K--R--E--K--Y--Y--D--S--K--G--I--G--C--Y--M--F--R--I--D--D--S--E--V--V--D--A--T--M--H--G--N-
GACTGACAAGCGGGAAAAGTATTACGACAGCAAGGGCATTGGTTGCTATATGTTCCGAATTGATGACTCAGAGGTAGTGGATGCCACCATGCATGGAAAT
.::.::::::::.::.::::::::.::::::::::::::.::::::::.:::::::::::.:::::::: ::::: :::::::::::::::::.::::::
AACCGACAAGCGAGAGAAGTATTATGACAGCAAGGGCATCGGTTGCTACATGTTCCGAATCGATGACTCTGAGGTCGTGGATGCCACCATGCACGGAAAT
--T--D--K--R--E--K--Y--Y--D--S--K--G--I--G--C--Y--M--F--R--I--D--D--S--E--V--V--D--A--T--M--H--G--N-

----------------------------------------------------------------------------------------------------
-A--A--R--F--I--N--H--S--C--E--P--N--C--Y--S--R--V--I--N--I--D--G--Q--K--H--I--V--I--F--A--M--R--K--
GCTGCACGCTTCATCAATCACTCGTGTGAGCCTAACTGCTATTCTCGGGTCATCAATATTGATGGGCAGAAGCACATTGTCATCTTTGCCATGCGTAAGA
::.:: ::::::::::::::::: :::::::::::::::::.::.::.:::::::::::.::.::::::::::::::::::::::::::::::::.::::
GCCGCCCGCTTCATCAATCACTCCTGTGAGCCTAACTGCTACTCCCGAGTCATCAATATCGACGGGCAGAAGCACATTGTCATCTTTGCCATGCGCAAGA
-A--A--R--F--I--N--H--S--C--E--P--N--C--Y--S--R--V--I--N--I--D--G--Q--K--H--I--V--I--F--A--M--R--K--

----------------------------------------------------------------------------------------------------
I--Y--R--G--E--E--L--T--Y--D--Y--K--F--P--I--E--D--A--S--N--K--L--P--C--N--C--G--A--K--K--C--R--K--F
TCTACCGAGGAGAGGAACTCACTTACGACTATAAGTTCCCCATTGAGGATGCCAGCAACAAGCTGCCCTGCAACTGTGGCGCCAAGAAATGCCGGAAGTT
::::::::::.:::::::::::::::::::::::::::::::::::::::::::::::::::.:.::::::::::::::.::::::::::::::::::::
TCTACCGAGGGGAGGAACTCACTTACGACTATAAGTTCCCCATTGAGGATGCCAGCAACAAGTTACCCTGCAACTGTGGTGCCAAGAAATGCCGGAAGTT
I--Y--R--G--E--E--L--T--Y--D--Y--K--F--P--I--E--D--A--S--N--K--L--P--C--N--C--G--A--K--K--C--R--K--F

----------
--L--N--*-
CCTAAACTAA
::::::::::
CCTAAACTAA
--L--N--*-

Pig Consensus Sequence

>BGISUST0000879909
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
---GGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCCGCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTG
GGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAGTTCTTAGGTTTTGGCTCAGATGAAGAAGTCAGAGTACGAAGTCCCACAAGGTCTCCTTC
A---------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
------------------------------------------------------------------------------------CCACAGTACTTTTCCT
CAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGCCCCCCTCCACTAACTCCTGAGGATGTCGGCTTCGCATCCGGGTT
TTCTACATCTGGTACTGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATGCACAAACGGAGCCCTCTTCTGAGAGCTCCA
AGATTTACTCCAAGCGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAATCGAACTTCTGCTGGAACATCTTCTTCAGGATTATCGAACA
GGAAAAGGAAAAGAAAAGTGTTTAGCCCTATTCGATCTGAACCAAGATCTCCTTCTCACTCCATGAGGACAAGAAGCGGAAGGCTTAGCACTTCGGAGCT
GTCACCTCTCACCCCACCGTCTTCTGTCTCTTCCTCGTTAAGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCT
CATTCCCTGACTCAGTCTGGGGAATCTGCAGAGAAAAACCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCCAGTAGTCCCACTC
CTCTccCCTGGTTTACCCCAGGCTCTCAGACTGAAAGAGGGAGGAATAAAGACAAGGCCCCTGAGGAGCTGTCCAAAGAGCGAGATGCTGACAAGAGCGT
GGAGAAGGACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAAGAGAATAAGCGGGAGTCCAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAGAGT
AGCTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTCGTTGATGAAGATGTGGCCACTTCATCTTCTGCCAAAAAAGCAACAGGGCGGAAGA
AGTCTTCATCACTTGATTCTGGGACTGATATTGCTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATACTTATAAAGAAAGGGAGAGGAAA
TCTGGAAAAAAACAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGCCTTTCCACTCCTTCATCTAGCACTGTTAAACAT
TCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGACAAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCCCAGCTCT
GCAAGATTGAGAAGAGTAAGAGTCTTAAACAGACTGACCAGCCCAAAGCACAGGGTCAAGAAAGTGACTCGTCGGAGACCTCAGTGCGAGGACCCCGAAT
TAAACATGTCTGCAGAAGAGCTGCTGTTGCCCTTGGCCGAAAACGAGCTGTGTTTCCTGATGATATGCCCACCCTGAGTGCCTTACCGTGGGAAGAACGA
GAAAAAATTTTGTCTTCCATGGGGAATGAT---AAGTCATCGATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCGCCCATCAAACCAATTAAACCTG
TCACCAGAAACAAGGCTCCGCAGGAACCTCCGGTAAAGAAAGGAAGGCGATCAAGGCGGTGTGGGCAGTGTCCTGGCTGCCAGGTGCCTGAGGACTGTGG
TGTTTGCACTAATTGTCTGGACAAGCCCAAGTTTGGTGGCCGCAACATAAAGAAGCAGTGCTGC---ATGAGAAAATGTCAGAATCTACAGTGGATGCCT
TCCAAATCCTACCTTCAAAAGCAAGCAAAA---GTGAAAAAGAAAGAGAAAAAGTCTAAGACTAGTGAAAAGAAAGAGAGCAAAGAGAGCAGCGTTGTGA
AGAACTTGGTGGACTCTAGTCAGAAATCTACCCCAGCAGCAAGAGAGGATCCCACCCCCAAGAAAAGCAACAGTGAACCTCCTCCTCGCAAGCCGGTGGA
GGACAAGAGTGAGGAAGGGAATGCCTCCGCCTCGGCCCCTGAGGCCAAGCAGGTGGCTGCACCCACCTCCAGGAAGTCCAACAAGCAGGCCTCCCAGCCA
ACACCAGCCATCCCCCCACAGCCACCCAGCACAGCACCACCGAGAAAAGAAGTTCCCAAGACCACTCCTAGTGAGCCTAAGAAAAAGCAGCCTCCACCTC
CGGAG------CCAGAACAAAGCAAGCAGAAAAAAGTGGCTCCTCGCCCAAGTATTCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCAGT
CAATAAGCAGGAGAACGCAGGCACTTTGAACATCCTCAGCACTTTCTCCAATGGCAATAGTTCCAAGCAAAAAATCCCAGCAGATGGAGTCCACAGGATC
AGAGTGGACTTTAAGGAGGATTGTGAAGCGGAAAATGTGTGGGAAATGGGAGGCTTAGGAATCTTGACCTCTGTTCCTATAACACCCAGGGTGGTTTGCT
TTCTGTGTGCCAGTAGTGGGCATGTAGAGTTTGTGTATTGCCAAGTCTGTTGTGAACCCTTCCACAAGTTTTGTTTAGAGGAGAACGAGCGCCCTCTGGA
GGACCAGCTGGAAAATTGGTGTTGTCGTCGCTGCAAGTTCTGTCATGTTTGTGGAAGGCAGCATCAGGCTACAAAGCAGCTACTGGAGTGTAATAAGTGC
CGAAACAGCTATCACCCTGAGTGCCTGGGACCAAACTACCCCACCAAACCCGCAAAA-------------------------------------------
-----------------------------------------------------------------------------------------------AACTT
CTGCCCTCTCTGTGATAAGTGTTATGATGATGATGACTATGAGAGTAAGATGATGCAGTGTGGGAAATGCGATCGCTGGGTCCATTCCAAATGTGAGAAT
CTTTCA----------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
-------------------------------------------------TCTCCAGAAGGACCTGATCCACCAGTGCTTACTGAGGTCAGCAAACAGGAA
GATCAACAGCCTTTAGATCTGGAAGGAGTGAAGAGGAAAATGGACCAAGGGAACTACACATCTGTG----------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------AGTGGGATGTTACCAAACGCAGTGCTTCCACCTTCACTTGACCATAAT
TATGCTCAGTGGCAGGAGCGAGAGGAAAACAGCCACACTGAGCAGCCTCCTTTAATGAAGAAAATCATTCCAGCTCCCAAACCTAAAGGGCCTGGAGAAC
CAGACTCACCAACTCCTCTGCATCCTCCTACACCACCAATTTTG---ACTGATAGAAGTCGAGAAGATAGTCCAGAACTGAACCCACCACCAGGCATAGA
AGATAATAGACAGTGTGCATTGTGTTTGACGTATGGGGACGACAGTGCTAATGATGCTGGCCGTTTGCTCTACATTGGCCAAAATGAGTGGACACATGTA
AATTGCGCTTTGTGGTCAGCAGAAGTGTTTGAAGATGATGATGGATCACTAAAGAATGTGCATATGGCTGTGATCAGGGGCAAGCAGCTG----------
----------------------------------------------------------------------------------------------------
-------------------------------------------------GTGGTTCCTGAGAATGGATTTGAAGTTTTTAGAAGAGTGTTTGTGGACTTT
----------------------------------------------------------------------------------------------------
-----------------------------------------------TGTTCGAGGGTGTACTGGAGCACCACAGATGCTCGCAAGCGCTGTGTGTACAC
GTGCAAGATAGTCGAATGCCGTCCTCCAGTTGTAGAGCCAGACATCAACAGCACTGTTGAACATGATGAAAATAGAACCATCGCTCACAGTCCATCATCT
TTT------ATTTCATCTAAGGAGAGTCAAAACACAGCTGAAATTGTAAGTCCTCCATCACCAGACCGACCTCCTCATTCACAGACCTCGGGTTCCTGTT
TTTATCATGTCATCTCAAAGGTCCCTAGGATTCGAACACCCAGTTACTCTCCAACGCAGAGATCCCCTGGCTGTCGGCCACTGCCTTCTGCA---AGCCC
TACCCCAACTACCCATGAAATAGTCACAGTGGGTGACCCTTTACTCTCCTCTGGACTTCGAAGCATTGGCTCCAGGCGTCACAGTACCTCTTCTTTGTCA
CCCCAGAGGTCGAAGCTCCGGATAATGTCTCCAATGAGGACTGGGGGTACTTACTCCAGGAATAGCGTTTCCTCACTCTCCACCATAGGGACCACTACCG
ATCTTGAGTCAAGTGCCAAAGCAGCTGATCATGTCTTAGGGCCACTGAATTCAAATACTAATTTAGGGCAAAACACTCCCACCTCTTCAAATTTGCAAAG
GACAGTGGTTACTCTGGGCACTAAAACCAGTCACTTGGACGGCCCTTCGTCTTCAGAGATGAAGCACTCTAGTGCCTCAGACTCGACCTCCAAGAGCTCC
TCTTTGAAGGGAGAAAAGACCAAAATGCCGAGTTCCAAGAACTCGGAGGGGTCTGCACATAACGTGGCTTACCCTGGCATTCCGAAACTGGCCCCACAGG
TTCATAATACAACATCTGGAGAATTGAACGTTAGTAAAATGGGCACTTTCGCTGAACTCTCTTCAGTGCCATTTTCTTCTAAAGAGGCCCTCCCGTTCCC
ACCACTCCATTTGAGAGGGCAAAGGAACGATCGAGACCAACAGCCAGATTCTAACCAGTTGGCAAACCCTCCTCCCGATGAAGATACTGAAGTCAAAACT
TTGAAGTTGTCTGGAGTGAGCAGCAGAGCGTCCACTATCAGTGAACACGTGGGATCTAGTTCCAGAGACAGGAGACAGAAAGGGAAAAAATCTGGTAAAG
ACACTTTCAAAGAAAAGCATTCCAGTAAATCTTTTTTGGAACCTGGTCAGGTGACAACTGGTGAGGAAGGAAACCTAAAGCCAGAGTTCATGGATGAAGT
TTTGACTCCTGAGTTCATGGGGCAACGACCATGTAATAATGTTTCTTCTGATAAGATTGGGGACAAAGTCCATTCTATTGCAGGAGTCCCCAAAGCTGCA
TCCATGCAAGTAGAAGGGTCTGCCAAGGAATTACAGACACCCCGGAAACGCACAGTCAAAGTAACACTGACACCTCTAAAAATGGAGAGCGAGAGTCAGT
CCAAGAATACCCTGAAAGAAAGTAGTCCTGTTTCCCCTCTGCAGATAGAGCCAGCATCTCCGACAGAACCAGTCTCAGCCTCTGAAAGTCCAGGAGATGG
TCCAGTAGCCCAGCCAAGCCCCAATAATACCTCCTCCCAGGATTCTCAAAGTAACAGCTATCAGAATCTTCCAGTACAGGACAGAAACCTAATGCTTCCA
GATGGGCCCAAACCTCAGGAGGATGGCTCTTTCAAGAGGAGGTAT-------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
-------------------------------------------ACTCCAGGAGCAGAGGCTGAGCAGCAAGAAACAGCTAGTGTGGAGCAGTCATCACAG
AAGGGATGTGGGCAGCCTGCA---------------------------------------------------------------------CCTAAAACAG
CAGAAGAAGAAGAAAGTAATTTCAGCTCTCCACTGATGCTTGGGCTCCAGCAAGAACAGAAGCGGAAGGAAAGCATTGCTGAGAAAAAGCCCAAGAAAGG
TCTTGTTTTTGAAATTTCAAGTGATGATGGCTTTCAGATCTGTGCGGAAAGTATTGAA---GCCTGGAAATCATTGACAGATAAAGTCCAGGAAGCTCGG
TCAAATGCCCGCCTAAAGCAGCTTTCATTTGCA---GTGAATGGTTTGAGGATGCTGGGGATTCTCCATGATGCGGTTGTGTTCCTGATTGAGCAGCTGT
CTGGTGCCAAGCACTGTAGGAATTACAAATTCCGTTTCCACAAGCCAGAGGAGGCCAATGAACCCCCCCTGAACCCTCATGGCTCAGCCAGGGCTGAGGT
CCACCTGAGG---TCAGCATTTGACATGTTTAACTTCCTGGCTTCTAAACATCGGCAGCCTCCTGAA---------------------------------
----------------------------------------------------------------------------------------------------
--TCTCCCATCCACGGCCGGGGTCTTTTTTGTAAAAGAAACATTGACGCGGGTGAGATGGTGATTGAGTACGCCGGCAATGTCATCCGTTCCATCCAAAC
CGACAAGCGAGAGAAGTATTATGACAGCAAGGGCATCGGTTGCTACATGTTCCGAATCGATGACTCTGAGGTCGTGGATGCCACCATGCACGGAAATGCC
GCCCGCTTCATCAATCACTCCTGTGAGCCTAACTGCTACTCCCGAGTCATCAATATCGACGGGCAGAAGCACATTGTCATCTTTGCCATGCGCAAGATCT
ACCGAGGGGAGGAACTCACTTACGACTATAAGTTCCCCATTGAGGATGCCAGCAACAAGTTACCCTGCAACTGTGGTGCCAAGAAATGCCGGAAGTTCCT
AAACTAA


>BGISUSP0000879909
----------------------------------------------------------------------------------------------------
-GPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPS---------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------PQYFSSAKYAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSTSGTAASARLFSPLHSGTRFDMHKRSPLLRAP
RFTPSEAHSRIFESVTLPSNRTSAGTSSSGLSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSTSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPS
HSLTQSGESAEKNQRPRKQTSAPAEPFSSSSPTPLPWFTPGSQTERGRNKDKAPEELSKERDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQS
SSALYPVGRVSKEKVVDEDVATSSSAKKATGRKKSSSLDSGTDIASVTLGDTTAVKTKILIKKGRGNLEKNNLDLGPTAPSLEKEKTLCLSTPSSSTVKH
STSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALGRKRAVFPDDMPTLSALPWEER
EKILSSMGND-KSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVCTNCLDKPKFGGRNIKKQCC-MRKCQNLQWMP
SKSYLQKQAK-VKKKEKKSKTSEKKESKESSVVKNLVDSSQKSTPAAREDPTPKKSNSEPPPRKPVEDKSEEGNASASAPEAKQVAAPTSRKSNKQASQP
TPAIPPQPPSTAPPRKEVPKTTPSEPKKKQPPPPE--PEQSKQKKVAPRPSIPVKQKPKEKEKPPPVNKQENAGTLNILSTFSNGNSSKQKIPADGVHRI
RVDFKEDCEAENVWEMGGLGILTSVPITPRVVCFLCASSGHVEFVYCQVCCEPFHKFCLEENERPLEDQLENWCCRRCKFCHVCGRQHQATKQLLECNKC
RNSYHPECLGPNYPTKPAK----------------------------------------------NFCPLCDKCYDDDDYESKMMQCGKCDRWVHSKCEN
LS---------------------------------------------------------------------------------SPEGPDPPVLTEVSKQE
DQQPLDLEGVKRKMDQGNYTSV--------------------------------------------------------------SGMLPNAVLPPSLDHN
YAQWQEREENSHTEQPPLMKKIIPAPKPKGPGEPDSPTPLHPPTPPIL-TDRSREDSPELNPPPGIEDNRQCALCLTYGDDSANDAGRLLYIGQNEWTHV
NCALWSAEVFEDDDGSLKNVHMAVIRGKQL-----------------------------------------------------VVPENGFEVFRRVFVDF
-------------------------------------------------CSRVYWSTTDARKRCVYTCKIVECRPPVVEPDINSTVEHDENRTIAHSPSS
F--ISSKESQNTAEIVSPPSPDRPPHSQTSGSCFYHVISKVPRIRTPSYSPTQRSPGCRPLPSA-SPTPTTHEIVTVGDPLLSSGLRSIGSRRHSTSSLS
PQRSKLRIMSPMRTGGTYSRNSVSSLSTIGTTTDLESSAKAADHVLGPLNSNTNLGQNTPTSSNLQRTVVTLGTKTSHLDGPSSSEMKHSSASDSTSKSS
SLKGEKTKMPSSKNSEGSAHNVAYPGIPKLAPQVHNTTSGELNVSKMGTFAELSSVPFSSKEALPFPPLHLRGQRNDRDQQPDSNQLANPPPDEDTEVKT
LKLSGVSSRASTISEHVGSSSRDRRQKGKKSGKDTFKEKHSSKSFLEPGQVTTGEEGNLKPEFMDEVLTPEFMGQRPCNNVSSDKIGDKVHSIAGVPKAA
SMQVEGSAKELQTPRKRTVKVTLTPLKMESESQSKNTLKESSPVSPLQIEPASPTEPVSASESPGDGPVAQPSPNNTSSQDSQSNSYQNLPVQDRNLMLP
DGPKPQEDGSFKRRY-------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
---------------------------------------------------------------------------------TPGAEAEQQETASVEQSSQ
KGCGQPA-----------------------PKTAEEEESNFSSPLMLGLQQEQKRKESIAEKKPKKGLVFEISSDDGFQICAESIE-AWKSLTDKVQEAR
SNARLKQLSFA-VNGLRMLGILHDAVVFLIEQLSGAKHCRNYKFRFHKPEEANEPPLNPHGSARAEVHLR-SAFDMFNFLASKHRQPPE-----------
----------------------------------SPIHGRGLFCKRNIDAGEMVIEYAGNVIRSIQTDKREKYYDSKGIGCYMFRIDDSEVVDATMHGNA
ARFINHSCEPNCYSRVINIDGQKHIVIFAMRKIYRGEELTYDYKFPIEDASNKLPCNCGAKKCRKFLN*