Sequences
EST Library Info
nco1Newborn 115 days, colon
Clusters
Oligos
SNPs

Gene ID ENSG00000160613 (click for geneview)
Transcript ID ENST00000359386(link to ensembl)
Localtion Chromosome:11:116581004:116608021:-1 band: 11q23.3
Description Proprotein convertase subtilisin/kexin type 7 precursor (EC 3.4.21.-) (Proprotein convertase PC7) (Subtilisin/kexin-like protease PC7) (Prohormone convertase PC7) (PC8) (hPC8) (Lymphoma proprotein convertase). [Source:Uniprot/SWISSPROT;Acc:Q16549]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--P--K--G--R--Q--K--V--P--H--L--D--A--P--L--G--L--P--T--C--L--W--L--E--L--A--G--L--F--L--L--V--P--
ATGCCGAAGGGGAGGCAGAAAGTGCCACACTTGGATGCCCCCCTGGGCCTGCCCACCTGCCTCTGGCTGGAATTAGCCGGGCTCTTCTTACTGGTTCCCT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
W--V--M--G--L--A--G--T--G--G--P--D--G--Q--G--T--G--G--P--S--W--A--V--H--L--E--S--L--E--G--D--G--E--E
GGGTCATGGGCCTGGCAGGGACAGGTGGGCCTGATGGCCAGGGCACAGGGGGGCCGAGCTGGGCTGTGCACCTGGAAAGCCTGGAAGGTGACGGGGAGGA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--E--T--L--E--Q--Q--A--D--A--L--A--Q--A--A--G--L--V--N--A--G--R--I--G--E--L--Q--G--H--Y--L--F--V--Q-
AGAGACTCTGGAGCAGCAGGCGGATGCCTTGGCCCAGGCAGCAGGGCTGGTGAATGCTGGACGCATCGGAGAGCTTCAGGGGCACTACCTCTTTGTCCAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-P--A--G--H--R--P--A--L--E--V--E--A--I--R--Q--Q--V--E--A--V--L--A--G--H--E--A--V--R--W--H--S--E--Q--
CCTGCTGGGCACAGGCCGGCCCTGGAGGTGGAGGCCATCCGGCAGCAGGTGGAGGCTGTGTTGGCTGGGCATGAAGCTGTGCGCTGGCACTCAGAGCAGA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-------------------------------------------------------------------><-------------------------------
R--L--L--R--R--A--K--R--S--V--H--F--N--D--P--K--Y--P--Q--Q--W--H--L--N--N--R--R--S--P--G--R--D--I--N
GGCTGCTAAGGCGGGCCAAGCGCAGCGTCCACTTCAACGACCCCAAGTACCCGCAGCAATGGCACCTGAATAACCGACGGAGCCCGGGCAGGGACATCAA
                                                                    :.::::::.:::::::: ::::::::::::::
--------------------------------------------------------------------AGTAACCGGCGGAGCCCTGGCAGGGACATCAA
---------------------------------------------------------------------S--N--R--R--S--P--G--R--D--I--N

----------------------------------------------------------------------------------------------------
--V--T--G--V--W--E--R--N--V--T--G--R--G--V--T--V--V--V--V--D--D--G--V--E--H--T--I--Q--D--I--A--P--N-
CGTGACGGGTGTGTGGGAACGCAATGTGACTGGGCGAGGGGTGACGGTGGTGGTAGTGGATGACGGAGTGGAACACACCATCCAGGACATTGCACCCAAC
::::::::: ::::::::.:::::::::::.::::::::::::::::::::::: :::::.::::: :::::.:::::::::::::::::.:: ::::::
CGTGACGGGGGTGTGGGAGCGCAATGTGACCGGGCGAGGGGTGACGGTGGTGGTCGTGGACGACGGCGTGGAGCACACCATCCAGGACATCGCTCCCAAC
--V--T--G--V--W--E--R--N--V--T--G--R--G--V--T--V--V--V--V--D--D--G--V--E--H--T--I--Q--D--I--A--P--N-

--><------------------------------------------------------------------------------------------------
-Y--S--P--E--G--S--Y--D--L--N--S--N--D--P--D--P--M--P--H--P--D--V--E--N--G--N--H--H--G--T--R--C--A--
TATAGCCCTGAGGGTAGCTATGACCTCAACTCTAATGACCCTGACCCCATGCCCCACCCGGATGTGGAGAATGGCAACCACCATGGCACGCGATGTGCAG
::::::::::::::.::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::.::.::.::.:
TATAGCCCTGAGGGCAGCTATGACCTCAACTCTAATGACCCTGACCCCATGCCCCACCCGGATGTGGAGAATGGCAACCACCATGGCACACGGTGCGCGG
-Y--S--P--E--G--S--Y--D--L--N--S--N--D--P--D--P--M--P--H--P--D--V--E--N--G--N--H--H--G--T--R--C--A--

--------------------------------------------------------------------><------------------------------
G--E--I--A--A--V--P--N--N--S--F--C--A--V--G--V--A--Y--G--S--R--I--A--G--I--R--V--L--D--G--P--L--T--D
GAGAGATCGCGGCTGTGCCCAACAACAGCTTCTGTGCCGTGGGCGTGGCCTACGGGAGCCGCATCGCAGGTATCCGGGTACTGGATGGACCTCTCACAGA
:::::::::: :::::::::::::::::::::::::: ::::: :::::::::::::::::::: :::   ::::::::::::::::::::.::::::::
GAGAGATCGCTGCTGTGCCCAACAACAGCTTCTGTGCAGTGGGAGTGGCCTACGGGAGCCGCATAGCA---ATCCGGGTACTGGATGGACCCCTCACAGA
G--E--I--A--A--V--P--N--N--S--F--C--A--V--G--V--A--Y--G--S--R--I--A-----I--R--V--L--D--G--P--L--T--D

-----------------------------------------------------------><---------------------------------------
--S--M--E--A--V--A--F--N--K--H--Y--Q--I--N--D--I--Y--S--C--S--W--G--P--D--D--D--G--K--T--V--D--G--P-
CAGCATGGAGGCAGTGGCGTTCAACAAGCACTATCAGATCAATGACATCTACAGCTGCAGCTGGGGACCAGATGACGATGGGAAGACAGTGGATGGCCCC
:::::::::::: :::::.:::::::::::::::::::::::::::::::::::::::   ::::::::::::::::::::.::::::::::::::::::
CAGCATGGAGGCCGTGGCATTCAACAAGCACTATCAGATCAATGACATCTACAGCTGC---TGGGGACCAGATGACGATGGAAAGACAGTGGATGGCCCC
--S--M--E--A--V--A--F--N--K--H--Y--Q--I--N--D--I--Y--S--C-----W--G--P--D--D--D--G--K--T--V--D--G--P-

--------------><------------------------------------------------------------------------------------
-H--Q--L--G--K--A--A--L--Q--H--G--V--I--A--G--R--Q--G--F--G--S--I--F--V--V--A--S--G--N--G--G--Q--H--
CATCAGCTTGGAAAGGCTGCCTTACAACATGGGGTGATTGCTGGTCGCCAGGGCTTTGGGAGCATCTTTGTGGTAGCCAGTGGCAACGGAGGCCAACACA
:::::::::::.:::::::::::.::::::::::::::.:::::.:::::::::::::::::::::::::::::.:::::::::::.::.:::::.::::
CATCAGCTTGGGAAGGCTGCCTTGCAACATGGGGTGATCGCTGGCCGCCAGGGCTTTGGGAGCATCTTTGTGGTGGCCAGTGGCAATGGGGGCCAGCACA
-H--Q--L--G--K--A--A--L--Q--H--G--V--I--A--G--R--Q--G--F--G--S--I--F--V--V--A--S--G--N--G--G--Q--H--

--------------------------------------------------------><------------------------------------------
N--D--N--C--N--Y--D--G--Y--A--N--S--I--Y--T--V--T--I--G--T--V--D--E--E--G--R--M--P--F--Y--A--E--E--C
ACGACAACTGCAACTACGATGGCTACGCCAACTCCATCTACACCGTCACCATAGGTACTGTGGATGAGGAGGGACGCATGCCTTTCTATGCAGAAGAATG
::::::::::::::::.::.:::::.::::::::::::::::: ::::::::::::                                            
ACGACAACTGCAACTATGACGGCTATGCCAACTCCATCTACACGGTCACCATAGGT--------------------------------------------
N--D--N--C--N--Y--D--G--Y--A--N--S--I--Y--T--V--T--I--G---------------------------------------------

------------------------------------------------------><--------------------------------------------
--A--S--M--L--A--V--T--F--S--G--G--D--K--M--L--R--S--I--V--T--T--D--W--D--L--Q--K--G--T--G--C--T--E-
TGCCTCCATGCTGGCAGTCACCTTCAGTGGTGGGGACAAGATGCTTCGGAGCATTGTGACCACTGACTGGGACCTTCAGAAGGGCACTGGCTGCACTGAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-G--H--T--G--T--S--A--A--A--P--L--A--A--G--M--I--A--L--M--L--Q--V--R--P--C--L--T--W--R--D--V--Q--H--
GGCCACACAGGGACCTCAGCTGCAGCGCCTCTGGCAGCTGGCATGATAGCCTTAATGCTGCAGGTGCGGCCCTGCCTCACGTGGCGTGACGTCCAGCACA
               :::::.::::: ::.:::::.:::::::::::::::.:.::::::::::::::::::::::::::::::::::::::::::::::
---------------TCAGCCGCAGCCCCCCTGGCGGCTGGCATGATAGCCCTGATGCTGCAGGTGCGGCCCTGCCTCACGTGGCGTGACGTCCAGCACA
----------------S--A--A--A--P--L--A--A--G--M--I--A--L--M--L--Q--V--R--P--C--L--T--W--R--D--V--Q--H--

----------------------><----------------------------------------------------------------------------
I--I--V--F--T--A--T--R--Y--E--D--R--R--A--E--W--V--T--N--E--A--G--F--S--H--S--H--Q--H--G--F--G--L--L
TCATTGTCTTCACAGCCACCCGGTATGAGGATCGCCGTGCAGAGTGGGTCACCAACGAGGCAGGCTTCAGCCATAGCCACCAGCACGGTTTCGGCCTCCT
::::.::::::::::::::::.:                                                                             
TCATCGTCTTCACAGCCACCCAG-----------------------------------------------------------------------------
I--I--V--F--T--A--T--Q------------------------------------------------------------------------------

------------------------------><--------------------------------------------------------------------
--N--A--W--R--L--V--N--A--A--K--I--W--T--S--V--P--Y--L--A--S--Y--V--S--P--V--L--K--E--N--K--A--I--P-
CAACGCCTGGAGGCTCGTGAATGCAGCCAAGATCTGGACATCTGTCCCTTACTTAGCATCCTACGTCAGTCCCGTGTTAAAAGAAAACAAGGCGATTCCG
                               ::::::::.:::::::: :::::::: :::::::::::.::::::::.:::::..::::::: ::.:::
-------------------------------ATCTGGACGTCTGTCCCGTACTTAGCTTCCTACGTCAGCCCCGTGTTGAAAGAGGACAAGGCTATCCCG
--------------------------------I--W--T--S--V--P--Y--L--A--S--Y--V--S--P--V--L--K--E--D--K--A--I--P-

---------------------------------><-----------------------------------------------------------------
-Q--S--P--R--S--L--E--V--L--W--N--V--S--R--M--D--L--E--M--S--G--L--K--T--L--E--H--V--A--V--T--V--S--
CAGTCCCCCCGTTCCCTGGAGGTCCTGTGGAATGTCAGCAGGATGGACCTGGAGATGTCAGGGCTGAAGACCCTGGAGCATGTGGCAGTGACAGTCTCCA
: :::  ::::..::::::::::::::::::::   :::::::..::::::::::::::.::::::::::::::::::::.::::: :::::::::::::
CTGTCAGCCCGCCCCCTGGAGGTCCTGTGGAAT---AGCAGGACAGACCTGGAGATGTCGGGGCTGAAGACCCTGGAGCACGTGGCCGTGACAGTCTCCA
-L--S--A--R--P--L--E--V--L--W--N-----S--R--T--D--L--E--M--S--G--L--K--T--L--E--H--V--A--V--T--V--S--

------------------------------------------------------------------------------------------><--------
I--T--H--P--R--R--G--S--L--E--L--K--L--F--C--P--S--G--M--M--S--L--I--G--A--P--R--S--M--D--S--D--P--N
TCACTCACCCACGGCGCGGCAGCTTGGAGCTGAAGCTGTTCTGCCCCAGTGGCATGATGTCCCTCATCGGCGCCCCCCGCAGCATGGACTCGGATCCCAA
::::::::::. :.::::::::::::::. ::::::: :::::::: :::::::::::::::::::::::.:::::::::::.::::::           
TCACTCACCCGAGACGCGGCAGCTTGGAAGTGAAGCTCTTCTGCCCGAGTGGCATGATGTCCCTCATCGGTGCCCCCCGCAGTATGGAC-----------
I--T--H--P--R--R--G--S--L--E--V--K--L--F--C--P--S--G--M--M--S--L--I--G--A--P--R--S--M--D------------

-------------------------------------------------------------------------------------><-------------
--G--F--N--D--W--T--F--S--T--V--R--C--W--G--E--R--A--R--G--T--Y--R--L--V--I--R--D--V--G--D--E--S--F-
CGGCTTCAATGACTGGACCTTCTCCACTGTGCGATGCTGGGGGGAGAGAGCCCGAGGGACCTACAGGCTTGTCATCAGGGATGTCGGGGATGAGTCATTC
                                                                                        ::::::  .:.:
----------------------------------------------------------------------------------------GATGAGAAGTCC
-----------------------------------------------------------------------------------------D--E--K--S-

-------------------------------------------------------------------------------><-------------------
-Q--V--G--I--L--R--Q--W--Q--L--T--L--Y--G--S--V--W--S--A--V--D--I--R--D--R--Q--R--L--L--E--S--A--M--
CAGGTCGGCATCCTCCGGCAATGGCAGCTGACCCTATATGGCTCTGTGTGGAGTGCAGTAGACATCAGGGACAGACAAAGGCTGTTAGAGAGTGCCATGA
::::.:::::::::::::::.::::::::::::::::::::::::::::::::: :::::::::::::::::::::::   ::..::::.::::::::::
CAGGCCGGCATCCTCCGGCAGTGGCAGCTGACCCTATATGGCTCTGTGTGGAGTCCAGTAGACATCAGGGACAGACAA---CTACTAGAAAGTGCCATGA
-Q--A--G--I--L--R--Q--W--Q--L--T--L--Y--G--S--V--W--S--P--V--D--I--R--D--R--Q-----L--L--E--S--A--M--

-------------------------------------------------------------------------------------------------><-
S--G--K--Y--L--H--D--D--F--A--L--P--C--P--P--G--L--K--I--P--E--E--D--G--Y--T--I--T--P--N--T--L--K--T
GTGGAAAATACCTGCACGATGACTTCGCCCTGCCCTGCCCACCGGGGCTGAAAATTCCTGAGGAAGATGGTTACACCATCACCCCCAACACCCTCAAGAC
::::.:::::::::::.::::.::::.: ::::::::::: :: :::::::::::.:::::::::::::::::::::::::: :: ::::::::::::::
GTGGGAAATACCTGCATGATGGCTTCACGCTGCCCTGCCCCCCCGGGCTGAAAATCCCTGAGGAAGATGGTTACACCATCACGCCGAACACCCTCAAGAC
S--G--K--Y--L--H--D--G--F--T--L--P--C--P--P--G--L--K--I--P--E--E--D--G--Y--T--I--T--P--N--T--L--K--T

----------------------------------------------------------------------------------------------------
--L--V--L--V--G--C--F--T--V--F--W--T--V--Y--Y--M--L--E--V--Y--L--S--Q--R--N--V--A--S--N--Q--V--C--R-
CCTGGTGCTGGTAGGCTGTTTCACCGTCTTCTGGACTGTTTACTACATGCTGGAAGTATATTTGAGCCAGAGGAATGTGGCTTCCAATCAAGTTTGTAGG
::::::::::.:::::::::::::.:::::::::::..::::::::::::::::.:::::..:::::::::::::::::::.::. :.: ::: ::::::
CCTGGTGCTGATAGGCTGTTTCACTGTCTTCTGGACCATTTACTACATGCTGGAGGTATACCTGAGCCAGAGGAATGTGGCCTCTCACCCAGTGTGTAGG
--L--V--L--I--G--C--F--T--V--F--W--T--I--Y--Y--M--L--E--V--Y--L--S--Q--R--N--V--A--S--H--P--V--C--R-

----------------------------------------------------------------------------------------------------
-S--G--P--C--H--W--P--H--R--S--R--K--A--K--E--E--G--T--E--L--E--S--V--P--L--C--S--S--K--D--P--D--E--
AGTGGACCCTGCCACTGGCCCCATCGGAGCCGGAAAGCCAAGGAGGAAGGGACAGAGCTAGAATCAGTGCCACTTTGCAGCAGCAAGGATCCAGACGAAG
::::::::::::::::::::::: :..:::::.::::::::::::::.::::::::.:::::: ::::::: :::::::::::: :::::::::..:.::
AGTGGACCCTGCCACTGGCCCCAGCAAAGCCGAAAAGCCAAGGAGGAGGGGACAGAACTAGAAGCAGTGCCCCTTTGCAGCAGCCAGGATCCAGGTGGAG
-S--G--P--C--H--W--P--Q--Q--S--R--K--A--K--E--E--G--T--E--L--E--A--V--P--L--C--S--S--Q--D--P--G--G--

----------------------------------------------------------------------------------------------------
V--E--T--E--S--R--G--P--P--T--T--S--D--L--L--A--P--D--L--L--E--Q--G--D--W--S--L--S--Q--N--K--S--A--L
TGGAAACAGAGAGCAGGGGCCCTCCCACCACCTCTGACCTCCTTGCCCCAGACCTGCTGGAGCAAGGGGACTGGAGCCTGTCCCAGAACAAGAGCGCCCT
:::..::.:::::...:::::::.::.:: ::::... :::: .::::::::::::::::: ::::::::::::::::::::::::::::...:.:::::
TGGGGACGGAGAGTGAGGGCCCTTCCGCCCCCTCCAGGCTCCGCGCCCCAGACCTGCTGGATCAAGGGGACTGGAGCCTGTCCCAGAACAGAGGTGCCCT
V--G--T--E--S--E--G--P--S--A--P--S--R--L--R--A--P--D--L--L--D--Q--G--D--W--S--L--S--Q--N--R--G--A--L

------------------------------------------------------------>
--D--C--P--H--Q-----H--L--D--V--P--H--G--K--E--E--Q--I--C--*-
GGACTGCCCTCATCAG---CACCTAGACGTACCGCACGGGAAGGAGGAGCAGATCTGCTGA
:::::::::::: :.    : ::.:::: :.:..:: :::::::. ::::::::.::::::
GGACTGCCCTCAGCGCCTCCCCCCAGACCTGCTACAGGGGAAGGGTGAGCAGATTTGCTGA
--D--C--P--Q--R--L--P--P--D--L--L--Q--G--K--G--E--Q--I--C--*-

Pig Consensus Sequence

>BGISUST0000892425
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
--------------------------------------------------------------------AGTAACCGGCGGAGCCCTGGCAGGGACATCAA
CGTGACGGGGGTGTGGGAGCGCAATGTGACCGGGCGAGGGGTGACGGTGGTGGTCGTGGACGACGGCGTGGAGCACACCATCCAGGACATCGCTCCCAAC
TATAGCCCTGAGGGCAGCTATGACCTCAACTCTAATGACCCTGACCCCATGCCCCACCCGGATGTGGAGAATGGCAACCACCATGGCACACGGTGCGCGG
GAGAGATCGCTGCTGTGCCCAACAACAGCTTCTGTGCAGTGGGAGTGGCCTACGGGAGCCGCATAGCA---ATCCGGGTACTGGATGGACCCCTCACAGA
CAGCATGGAGGCCGTGGCATTCAACAAGCACTATCAGATCAATGACATCTACAGCTGC---TGGGGACCAGATGACGATGGAAAGACAGTGGATGGCCCC
CATCAGCTTGGGAAGGCTGCCTTGCAACATGGGGTGATCGCTGGCCGCCAGGGCTTTGGGAGCATCTTTGTGGTGGCCAGTGGCAATGGGGGCCAGCACA
ACGACAACTGCAACTATGACGGCTATGCCAACTCCATCTACACGGTCACCATAGGT--------------------------------------------
----------------------------------------------------------------------------------------------------
---------------TCAGCCGCAGCCCCCCTGGCGGCTGGCATGATAGCCCTGATGCTGCAGGTGCGGCCCTGCCTCACGTGGCGTGACGTCCAGCACA
TCATCGTCTTCACAGCCACCCAG-----------------------------------------------------------------------------
-------------------------------ATCTGGACGTCTGTCCCGTACTTAGCTTCCTACGTCAGCCCCGTGTTGAAAGAGGACAAGGCTATCCCG
CTGTCAGCCCGCCCCCTGGAGGTCCTGTGGAAT---AGCAGGACAGACCTGGAGATGTCGGGGCTGAAGACCCTGGAGCACGTGGCCGTGACAGTCTCCA
TCACTCACCCGAGACGCGGCAGCTTGGAAGTGAAGCTCTTCTGCCCGAGTGGCATGATGTCCCTCATCGGTGCCCCCCGCAGTATGGAC-----------
----------------------------------------------------------------------------------------GATGAGAAGTCC
CAGGCCGGCATCCTCCGGCAGTGGCAGCTGACCCTATATGGCTCTGTGTGGAGTCCAGTAGACATCAGGGACAGACAA---CTACTAGAAAGTGCCATGA
GTGGGAAATACCTGCATGATGGCTTCACGCTGCCCTGCCCCCCCGGGCTGAAAATCCCTGAGGAAGATGGTTACACCATCACGCCGAACACCCTCAAGAC
CCTGGTGCTGATAGGCTGTTTCACTGTCTTCTGGACCATTTACTACATGCTGGAGGTATACCTGAGCCAGAGGAATGTGGCCTCTCACCCAGTGTGTAGG
AGTGGACCCTGCCACTGGCCCCAGCAAAGCCGAAAAGCCAAGGAGGAGGGGACAGAACTAGAAGCAGTGCCCCTTTGCAGCAGCCAGGATCCAGGTGGAG
TGGGGACGGAGAGTGAGGGCCCTTCCGCCCCCTCCAGGCTCCGCGCCCCAGACCTGCTGGATCAAGGGGACTGGAGCCTGTCCCAGAACAGAGGTGCCCT
GGACTGCCCTCAGCGCCTCCCCCCAGACCTGCTACAGGGGAAGGGTGAGCAGATTTGC


>BGISUSP0000892425
----------------------------------------------------------------------------------------------------
--------------------------------------------------------SNRRSPGRDINVTGVWERNVTGRGVTVVVVDDGVEHTIQDIAPN
YSPEGSYDLNSNDPDPMPHPDVENGNHHGTRCAGEIAAVPNNSFCAVGVAYGSRIA-IRVLDGPLTDSMEAVAFNKHYQINDIYSC-WGPDDDGKTVDGP
HQLGKAALQHGVIAGRQGFGSIFVVASGNGGQHNDNCNYDGYANSIYTVTIG------------------------------------------------
-----SAAAPLAAGMIALMLQVRPCLTWRDVQHIIVFTATQ------------------------------------IWTSVPYLASYVSPVLKEDKAIP
LSARPLEVLWN-SRTDLEMSGLKTLEHVAVTVSITHPRRGSLEVKLFCPSGMMSLIGAPRSMD---------------------------------DEKS
QAGILRQWQLTLYGSVWSPVDIRDRQ-LLESAMSGKYLHDGFTLPCPPGLKIPEEDGYTITPNTLKTLVLIGCFTVFWTIYYMLEVYLSQRNVASHPVCR
SGPCHWPQQSRKAKEEGTELEAVPLCSSQDPGGVGTESEGPSAPSRLRAPDLLDQGDWSLSQNRGALDCPQRLPPDLLQGKGEQIC