Sequences
EST Library Info
Clusters
Oligos
SNPs

Gene ID ENSG00000196663 (click for geneview)
Transcript ID ENST00000359520(link to ensembl)
Symbol KIAA0329
Localtion Chromosome:14:101899053:102034347:1 band: 14q32.32
Description  
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--A--S--I--S--E--P--V--T--F--R--E--F--C--P--L--Y--Y--L--L--N--A--I--P--T--K--I--Q--K--G--F--R--S--
ATGGCATCGATATCAGAGCCTGTTACATTCAGAGAGTTCTGCCCGTTGTACTATCTCCTCAATGCCATTCCGACAAAGATCCAGAAGGGTTTCCGCTCTA
                                                                                                ::..
------------------------------------------------------------------------------------------------TCCG
-------------------------------------------------------------------------------------------------S--

----------------------------------------------------------------------------------------------------
I--V--V--Y--L--T--A--L--D--T--N--G--D--Y--I--A--V--G--S--S--I--G--M--L--Y--L--Y--C--R--H--L--N--Q--M
TCGTGGTCTATCTCACGGCCCTCGACACCAACGGGGACTACATCGCGGTGGGCAGCAGCATCGGCATGCTCTATCTGTACTGCCGGCACCTCAACCAGAT
:  ::::::: :::::::::::::::.::::::::::::::::::: ::::::::::::.:::: ::::::::.:::::::  :: ::::::.:::.:::
TGCTGGTCTA-CTCACGGCCCTCGACGCCAACGGGGACTACATCGCCGTGGGCAGCAGCGTCGGGATGCTCTACCTGTACTTGCGCCACCTCGACCGGAT
V--L--V--Y--L--T--A--L--D--A--N--G--D--Y--I--A--V--G--S--S--V--G--M--L--Y--L--Y--L--R--H--L--D--R--M

---------------------><-----------------------------------------------------------------------------
--R--K--Y--N--F--E--G--K--T--E--S--I--T--V--V--K--L--L--S--C--F--D--D--L--V--A--A--G--T--A--S--G--R-
GAGGAAGTACAACTTTGAGGGGAAGACGGAATCTATCACTGTGGTGAAGCTGCTGAGCTGCTTTGATGACCTGGTGGCAGCAGGCACAGCCTCTGGCAGG
::.::::::::::: .::::::::.:::::.::.::::: ::::::::::::::::::::::::::.::::: ::::: ::::::::.:::::::: :::
GAAGAAGTACAACTGCGAGGGGAAAACGGAGTCCATCACGGTGGTGAAGCTGCTGAGCTGCTTTGACGACCTTGTGGCTGCAGGCACGGCCTCTGGGAGG
--K--K--Y--N--C--E--G--K--T--E--S--I--T--V--V--K--L--L--S--C--F--D--D--L--V--A--A--G--T--A--S--G--R-

--------------------------------------------------><------------------------------------------------
-V--A--V--F--Q--L--V--S--S--L--P--G--R--N--K--Q--L--R--R--F--D--V--T--G--I--H--K--N--S--I--T--A--L--
GTTGCAGTTTTTCAACTTGTATCTTCATTGCCAGGGAGAAATAAACAGCTTCGGAGATTTGATGTCACTGGTATTCACAAAAATAGCATTACAGCTCTGG
::::: ::.:::::.::.::.:: :: :::::.:::::::::::::::                                                    
GTTGCCGTCTTTCAGCTCGTGTCGTCCTTGCCGGGGAGAAATAAACAG----------------------------------------------------
-V--A--V--F--Q--L--V--S--S--L--P--G--R--N--K--Q-----------------------------------------------------

----------------------------------------------------------------------------------><----------------
A--W--S--P--N--G--M--K--L--F--S--G--D--D--K--G--K--I--V--Y--S--S--L--D--L--D--Q--G--L--C--N--S--Q--L
CTTGGAGCCCCAATGGAATGAAATTGTTCTCTGGAGATGACAAAGGCAAAATTGTTTATTCTTCTCTGGATCTAGACCAGGGGCTCTGTAACTCCCAGCT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--V--L--E--E--P--S--S--I--V--Q--L--D--Y--S--Q--K--V--L--L--V--S--T--L--Q--R--S--L--L--F--Y--T--E--E-
GGTGTTGGAGGAGCCATCTTCCATTGTGCAGCTGGATTATAGCCAGAAAGTGCTGCTGGTCTCTACTCTGCAAAGAAGTCTGCTCTTTTACACTGAAGAA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------><----------------------------------------------------------
-K--S--V--R--Q--I--G--T--Q--P--R--K--S--T--G--K--F--G--A--C--F--I--P--G--L--C--K--Q--S--D--L--T--L--
AAGTCTGTAAGGCAAATTGGAACACAACCAAGGAAAAGTACTGGGAAATTTGGTGCTTGTTTTATACCAGGACTCTGTAAGCAAAGTGATCTAACCTTGT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
Y--A--S--R--P--G--L--R--L--W--K--A--D--V--H--G--T--V--Q--A--T--F--I--L--K--D--A--F--A--G--G--V--K--P
ATGCGTCACGGCCCGGGCTCCGGCTATGGAAGGCTGATGTCCACGGGACTGTTCAAGCCACGTTTATCTTAAAAGATGCTTTTGCCGGGGGAGTCAAGCC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--F--E--L--H--P--R--L--E--S--P--N--S--G--S--C--S--L--P--E--R--H--L--G--L--V--S--C--F--F--Q--E--G--W-
TTTTGAACTGCACCCGCGTCTGGAATCCCCCAACAGTGGAAGTTGCAGCTTACCTGAGAGGCACCTGGGGCTTGTTTCATGTTTCTTTCAAGAAGGCTGG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-----------------------------------------------------><---------------------------------------------
-V--L--S--W--N--E--Y--S--I--Y--L--L--D--T--V--N--Q--A--T--V--A--G--L--E--G--S--G--D--I--V--S--V--S--
GTGCTGAGTTGGAATGAATATAGTATCTATCTCCTAGACACAGTCAACCAGGCCACAGTTGCTGGTTTGGAAGGATCCGGTGATATTGTGTCTGTTTCGT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

--------------------------------------------------------------------------------------><------------
C--T--E--N--E--I--F--F--L--K--G--D--R--N--I--I--R--I--S--S--R--P--E--G--L--T--S--T--V--R--D--G--L--E
GCACAGAAAATGAAATATTTTTCTTGAAAGGAGATAGGAACATTATAAGAATTTCAAGCAGGCCTGAAGGATTAACATCAACAGTGAGAGATGGTCTGGA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--M--S--G--C--S--E--R--V--H--V--Q--Q--A--E--K--L--P--G--A--T--V--S--E--T--R--L--R--G--S--S--M--A--S-
GATGTCTGGATGCTCAGAGCGTGTCCACGTGCAGCAAGCGGAGAAGCTGCCAGGGGCCACAGTTTCTGAGACGAGGCTCAGAGGCTCTTCCATGGCCAGC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-S--V--A--S--E--P--R--S--R--S--S--S--L--N--S--T--D--S--G--S--G--L--L--P--P--G--L--Q--A--T--P--E--L--
TCCGTGGCCAGCGAGCCAAGGAGCAGGAGCAGCTCGCTCAACTCCACCGACAGCGGCTCCGGGCTCCTGCCCCCTGGGCTCCAGGCCACCCCTGAGCTGG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
G--K--G--S--Q--P--L--S--Q--R--F--N--A--I--S--S--E--D--F--D--Q--E--L--V--V--K--P--I--K--V--K--R--K--K
GCAAGGGCAGCCAGCCCCTGTCACAGAGATTCAACGCCATCAGCTCAGAGGACTTTGACCAGGAGCTTGTCGTGAAGCCTATCAAAGTGAAAAGGAAGAA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-------------------><-------------------------------------------------------------------------------
--K--K--K--K--T--E--G--G--S--R--S--T--C--H--S--S--L--E--S--T--P--C--S--E--F--P--G--D--S--P--Q--S--L-
GAAGAAGAAGAAGACAGAAGGTGGAAGCAGGAGCACCTGTCACAGCTCCCTGGAATCGACACCCTGCTCCGAATTTCCTGGGGACAGTCCCCAGTCCTTG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-N--T--D--L--L--S--M--T--S--S--V--L--G--S--S--V--D--Q--L--S--A--E--S--P--D--Q--E--S--S--F--N--G--E--
AACACAGACTTGCTGTCGATGACCTCAAGTGTCCTGGGCAGTAGCGTGGATCAGTTAAGTGCAGAGTCTCCAGACCAGGAAAGCAGCTTCAATGGTGAAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
V--N--G--V--P--Q--E--N--T--D--P--E--T--F--N--V--L--E--V--S--G--S--M--P--D--S--L--A--E--E--D--D--I--R
TGAACGGTGTCCCACAGGAAAATACTGACCCCGAAACGTTTAATGTCCTGGAGGTGTCAGGATCAATGCCTGATTCTCTGGCTGAGGAAGATGACATTAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--T--E--M--P--H--C--H--H--A--H--G--R--E--L--L--N--G--A--R--E--D--V--G--G--S--D--V--T--G--L--G--D--E-
AACTGAAATGCCACACTGTCACCATGCACATGGGCGGGAGCTGCTCAATGGAGCGAGGGAAGATGTGGGAGGCAGTGATGTCACGGGACTCGGAGATGAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-P--C--P--A--D--D--G--P--N--S--T--Q--L--P--F--Q--E--Q--D--S--S--P--G--A--H--D--G--E--D--I--Q--P--I--
CCGTGTCCTGCAGATGATGGACCAAATAGCACACAGTTACCCTTCCAAGAACAGGACAGCTCTCCTGGGGCGCATGATGGGGAAGACATCCAACCCATTG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
G--P--Q--S--T--F--C--E--V--P--L--L--N--S--L--T--V--P--S--S--L--S--W--A--P--S--A--E--Q--W--L--P--G--T
GCCCCCAAAGCACTTTTTGTGAAGTCCCCCTCCTGAACTCACTCACTGTGCCTTCCAGCCTCAGCTGGGCCCCAAGTGCTGAACAGTGGCTGCCTGGGAC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--R--A--D--E--G--S--P--V--E--P--S--Q--E--Q--D--I--L--T--S--M--E--A--S--G--H--L--S--T--N--L--W--H--A-
CAGAGCTGATGAAGGCAGCCCCGTGGAGCCCAGCCAAGAGCAGGACATCCTAACCAGCATGGAGGCCTCTGGCCACCTCAGCACAAATCTCTGGCATGCT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-V--T--D--D--D--T--G--Q--K--E--I--P--I--S--E--R--V--L--G--S--V--G--G--Q--L--T--P--V--S--A--L--A--A--
GTCACTGATGATGACACAGGTCAGAAAGAAATACCCATTTCTGAACGTGTCTTGGGGAGTGTGGGAGGACAGCTGACTCCGGTCTCTGCCTTGGCAGCCA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
S--T--H--K--P--W--L--E--Q--P--P--R--D--Q--T--L--T--S--S--D--E--E--D--I--Y--A--H--G--L--P--S--S--S--S
GCACTCACAAGCCCTGGCTTGAGCAGCCTCCACGGGATCAGACATTGACGTCCAGCGATGAGGAGGACATCTATGCCCACGGGCTTCCTTCTTCATCCTC
                    ::::::::: :::::::.:::... :::::::::::::.:::::::::::::::::::: ::::::::.::.::.:::::
--------------------GAGCAGCCTGCACGGGACCAGGTGGTGACGTCCAGCGACGAGGAGGACATCTATGCCCAGGGGCTTCCCTCCTCGTCCTC
---------------------E--Q--P--A--R--D--Q--V--V--T--S--S--D--E--E--D--I--Y--A--Q--G--L--P--S--S--S--S

------------------------------------------------------------------------------------------------><--
--E--T--S--V--T--E--L--G--P--S--C--S--Q--Q--D--L--S--R--L--G--A--E--D--A--G--L--L--K--P--D--Q--F--A-
AGAGACGAGTGTGACAGAGCTCGGACCTAGTTGCTCCCAGCAGGACCTGAGCCGGCTGGGTGCAGAGGACGCCGGGCTGCTCAAGCCAGATCAGTTTGCA
 ::::: ::.:::.:.::::: ::  ::.:..:::::: :::::::::::::::::. ::: :::::::. ::::::::::::::.::::::::      
CGAGACTAGCGTGGCGGAGCTGGGCGCTGGCCGCTCCCTGCAGGACCTGAGCCGGCCCGGTCCAGAGGATCCCGGGCTGCTCAAGTCAGATCAG------
--E--T--S--V--A--E--L--G--A--G--R--S--L--Q--D--L--S--R--P--G--P--E--D--P--G--L--L--K--S--D--Q-------

----------------------------------------------------------------------------------------------------
-E--S--W--M--G--Y--S--G--P--G--Y--G--I--L--S--L--V--V--S--E--K--Y--I--W--C--L--D--Y--K--G--G--L--F--
GAAAGCTGGATGGGCTACTCGGGTCCCGGCTATGGCATCCTCAGCTTGGTGGTCTCCGAGAAGTATATCTGGTGCCTGGACTACAAAGGCGGCCTGTTCT
                                                         ::::::::..:::::::.:::::::::::::::::::::::::
---------------------------------------------------------GAGAAGTACGTCTGGTGTCTGGACTACAAAGGCGGCCTGTTCT
----------------------------------------------------------E--K--Y--V--W--C--L--D--Y--K--G--G--L--F--

--------------------------------------------------------------------------------><------------------
C--S--A--L--P--G--A--G--L--R--W--Q--K--F--E--D--A--V--Q--Q--V--A--V--S--P--S--G--A--L--L--W--K--I--E
GCAGCGCGTTGCCGGGCGCCGGGCTGCGCTGGCAGAAGTTTGAAGATGCTGTCCAGCAGGTGGCAGTCTCGCCCTCAGGAGCCCTTCTCTGGAAGATTGA
::::::::.::::::: :::::::::::::::::::.::::::::::::.:::::::::::::::::::: ::::::   ::::::::::::::::::::
GCAGCGCGCTGCCGGGGGCCGGGCTGCGCTGGCAGAGGTTTGAAGATGCCGTCCAGCAGGTGGCAGTCTCCCCCTCA---GCCCTTCTCTGGAAGATTGA
C--S--A--L--P--G--A--G--L--R--W--Q--R--F--E--D--A--V--Q--Q--V--A--V--S--P--S-----A--L--L--W--K--I--E

----------------------------------------------------------------------------------------------------
--Q--K--S--N--R--A--F--A--C--G--K--V--T--I--K--G--K--R--H--W--Y--E--A--L--P--Q--A--V--F--V--A--L--S-
ACAGAAATCTAACCGGGCTTTTGCTTGTGGGAAAGTCACCATCAAGGGGAAGCGGCACTGGTACGAAGCCCTGCCCCAGGCAGTGTTTGTGGCCCTGAGC
.::::::::.::::: ::.:::::::::::.::::: ::::::::::::::::: ::::::::::::::.:::::::::::.:::::.::::::::::::
GCAGAAATCCAACCGCGCCTTTGCTTGTGGAAAAGTGACCATCAAGGGGAAGCGTCACTGGTACGAAGCTCTGCCCCAGGCGGTGTTCGTGGCCCTGAGC
--Q--K--S--N--R--A--F--A--C--G--K--V--T--I--K--G--K--R--H--W--Y--E--A--L--P--Q--A--V--F--V--A--L--S-

------------------------------------------------------><--------------------------------------------
-D--D--T--A--W--I--I--R--T--S--G--D--L--Y--L--Q--T--G--L--S--V--D--R--P--C--A--R--A--V--K--V--D--C--
GATGACACGGCCTGGATCATCAGGACCAGTGGGGACCTATACTTGCAGACAGGTCTGAGCGTGGATCGCCCTTGTGCCAGAGCCGTAAAGGTGGACTGTC
::.::::::::::::::::::::::: :..::.:::::.:::.::::::::   :: ::::::::::::::.::. ::::.:::: ::::.: :::::::
GACGACACGGCCTGGATCATCAGGACAAACGGAGACCTGTACCTGCAGACA---CTCAGCGTGGATCGCCCCTGCCCCAGGGCCGAAAAGATCGACTGTC
-D--D--T--A--W--I--I--R--T--N--G--D--L--Y--L--Q--T-----L--S--V--D--R--P--C--P--R--A--E--K--I--D--C--

----------------------------------------------------------------------------------------------------
P--Y--P--L--S--Q--I--T--A--R--N--N--V--V--W--A--L--T--E--Q--R--A--L--L--Y--R--E--G--V--S--S--F--C--P
CCTACCCGCTGTCCCAGATCACAGCCCGGAACAATGTGGTGTGGGCGCTGACAGAGCAGAGGGCCCTCCTGTACCGGGAGGGCGTGAGCAGCTTCTGTCC
: :::::.:::::::::.::::::::::.::::..:::::::::::::::::.:: ::.::.:: ::::::::::::::::::::::::::::::::.::
CGTACCCACTGTCCCAGGTCACAGCCCGAAACAGCGTGGTGTGGGCGCTGACGGATCAAAGAGCGCTCCTGTACCGGGAGGGCGTGAGCAGCTTCTGCCC
P--Y--P--L--S--Q--V--T--A--R--N--S--V--V--W--A--L--T--D--Q--R--A--L--L--Y--R--E--G--V--S--S--F--C--P

-----------------------------------><---------------------------------------------------------------
--E--G--E--Q--W--K--C--D--I--V--S--E--R--Q--A--L--E--P--V--C--I--T--L--G--D--Q--Q--T--L--W--A--L--D-
GGAAGGCGAGCAGTGGAAGTGTGACATTGTCAGCGAAAGGCAAGCTTTAGAACCCGTCTGCATAACGCTCGGGGATCAGCAGACTCTCTGGGCCCTGGAC
 ::.:: :::::::::::.:::::::::.::                                                ::::: :: ::::::::::::
CGAGGGGGAGCAGTGGAAATGTGACATTATC------------------------------------------------CAGACGCTGTGGGCCCTGGAC
--E--G--E--Q--W--K--C--D--I--I--------------------------------------------------Q--T--L--W--A--L--D-

-----------------------------------------------------------------------------><---------------------
-I--H--G--N--L--W--F--R--T--G--I--I--S--K--K--P--Q--G--D--D--D--H--W--W--Q--V--S--I--T--D--Y--V--V--
ATCCATGGGAACCTGTGGTTCAGAACTGGCATTATTTCCAAGAAGCCCCAAGGAGATGACGACCATTGGTGGCAAGTGAGCATCACGGACTATGTGGTGT
::::. :: :::::::::::::::::::::::..: ::::::::::::::::::::.::::::::.::::::   :::::::::::.:::::.:::::.:
ATCCGGGGCAACCTGTGGTTCAGAACTGGCATCGTGTCCAAGAAGCCCCAAGGAGACGACGACCACTGGTGG---GTGAGCATCACAGACTACGTGGTAT
-I--R--G--N--L--W--F--R--T--G--I--V--S--K--K--P--Q--G--D--D--D--H--W--W-----V--S--I--T--D--Y--V--V--

----------------------------------------------------------------------------------------------------
F--D--Q--C--S--L--F--Q--T--I--I--H--A--T--H--S--V--A--T--A--A--Q--A--P--V--E--K--V--A--D--K--L--R--M
TTGACCAGTGCAGCTTATTTCAGACGATAATCCATGCCACTCACTCGGTGGCCACAGCAGCCCAAGCCCCCGTAGAAAAGGTGGCAGATAAGCTGCGCAT
:.::::::::::::::.::.::::: ::::::::.::::: :::::::::::::::::.:::::.:. ::.:: :::::::::::.:::::.::::::::
TCGACCAGTGCAGCTTGTTCCAGACCATAATCCACGCCACACACTCGGTGGCCACAGCGGCCCAGGTGCCTGTCGAAAAGGTGGCGGATAAACTGCGCAT
F--D--Q--C--S--L--F--Q--T--I--I--H--A--T--H--S--V--A--T--A--A--Q--V--P--V--E--K--V--A--D--K--L--R--M

----------------------------------------------------------------------------------------------------
--A--F--W--S--Q--Q--L--Q--C--Q--P--S--L--L--G--V--N--N--S--G--V--W--I--S--S--G--K--N--E--F--H--V--A-
GGCGTTTTGGTCCCAGCAGCTTCAGTGCCAGCCAAGCCTTCTCGGGGTCAATAACAGCGGTGTCTGGATCTCCTCGGGCAAGAATGAATTCCACGTCGCT
::::::::::::.::::::::::::::::::::.::::: :::::::::::.:.:::.::.:::::::::::::: ::::::::.::::::::::: :::
GGCGTTTTGGTCTCAGCAGCTTCAGTGCCAGCCGAGCCTGCTCGGGGTCAACAGCAGTGGCGTCTGGATCTCCTCTGGCAAGAACGAATTCCACGTGGCT
--A--F--W--S--Q--Q--L--Q--C--Q--P--S--L--L--G--V--N--S--S--G--V--W--I--S--S--G--K--N--E--F--H--V--A-

------------------><--------------------------------------------------------------------------------
-K--G--S--L--I--G--T--Y--W--N--H--V--V--P--R--G--T--A--S--A--T--K--W--A--F--V--L--A--S--A--A--P--T--
AAGGGAAGTCTCATAGGCACCTACTGGAATCATGTGGTTCCCCGTGGGACAGCTTCTGCTACAAAATGGGCCTTTGTGTTGGCTTCTGCAGCTCCCACGA
::.:::::::::      ::.::::::::: :.:: ::::::::::::::.::.::::: ::::::::::::::::::.:::::::..: :::::::: :
AAAGGAAGTCTC------ACTTACTGGAATAACGTTGTTCCCCGTGGGACGGCCTCTGCAACAAAATGGGCCTTTGTGCTGGCTTCCACCGCTCCCACCA
-K--G--S--L--------T--Y--W--N--N--V--V--P--R--G--T--A--S--A--T--K--W--A--F--V--L--A--S--T--A--P--T--

------------><--------------------------------------------------------------------------------------
K--E--G--G--F--L--W--L--C--Q--S--S--K--D--L--C--S--V--S--A--Q--S--A--Q--S--R--P--S--T--V--Q--L--P--P
AGGAAGGTGGCTTCCTGTGGCTGTGCCAGAGCAGCAAGGACCTGTGCAGCGTCAGCGCCCAGAGCGCACAGTCGCGGCCCTCCACGGTGCAGCTGCCTCC
:::::         ::::::::: :::::::::::::::::::::.::::.::::::::::: .::: ..::: :: :: ::::: ::::::::::::::
AGGAA---------CTGTGGCTGAGCCAGAGCAGCAAGGACCTGTACAGCATCAGCGCCCAGCACGCCTGGTCCCGCCCGTCCACCGTGCAGCTGCCTCC
K--E-----------L--W--L--S--Q--S--S--K--D--L--Y--S--I--S--A--Q--H--A--W--S--R--P--S--T--V--Q--L--P--P

----------------------------------------------------------------------------------------------------
--E--A--E--M--R--A--Y--A--A--C--Q--D--A--L--W--A--L--D--S--L--G--Q--V--F--I--R--T--L--S--K--S--C--P-
CGAAGCCGAGATGCGCGCCTATGCCGCCTGCCAGGATGCGCTGTGGGCGCTGGACAGCCTCGGCCAGGTGTTCATCAGGACGCTCTCCAAGAGCTGCCCC
::: ::::::::: : :::::.::.::::::::.::::: :::::::: ::::::::::: ::::::::::::::::.:::::: ::::.::::::::::
CGATGCCGAGATGAGGGCCTACGCTGCCTGCCAAGATGCCCTGTGGGCCCTGGACAGCCTGGGCCAGGTGTTCATCAAGACGCTGTCCAGGAGCTGCCCC
--D--A--E--M--R--A--Y--A--A--C--Q--D--A--L--W--A--L--D--S--L--G--Q--V--F--I--K--T--L--S--R--S--C--P-

------------------------------------------><--------------------------------------------------------
-T--G--M--H--W--T--R--L--D--L--S--Q--L--G--A--V--K--L--T--S--L--A--C--G--N--Q--H--I--W--A--C--D--S--
ACGGGCATGCACTGGACCAGGCTGGACCTCTCCCAGCTAGGAGCTGTAAAATTGACAAGCTTGGCATGTGGAAATCAGCACATCTGGGCCTGTGATTCCA
::::::::::::::::: :::::::::::.:::::::::   .:.::::.:.::::.:::::: :.::::::::.::::::.::::::::::.::.::::
ACGGGCATGCACTGGACGAGGCTGGACCTTTCCCAGCTA---ACCGTAAGACTGACGAGCTTGTCGTGTGGAAACCAGCACGTCTGGGCCTGCGACTCCA
-T--G--M--H--W--T--R--L--D--L--S--Q--L-----T--V--R--L--T--S--L--S--C--G--N--Q--H--V--W--A--C--D--S--

-------------------------------------------------------------------------------------------><-------
R--G--G--V--Y--F--R--V--G--T--Q--P--L--N--P--S--L--M--L--P--A--W--I--M--I--E--P--P--V--Q--P--A--G--V
GGGGTGGAGTTTACTTCCGTGTAGGGACTCAGCCTCTCAATCCCAGTCTCATGCTTCCAGCCTGGATAATGATTGAGCCACCTGTCCAGCCCGCCGGGGT
::::::: :::::::::::::::::.:: :::::::: ::.:::::::: ::::::::.:::::::: :::::.:::::.::::::::::: ::::::::
GGGGTGGCGTTTACTTCCGTGTAGGAACGCAGCCTCTGAACCCCAGTCTGATGCTTCCGGCCTGGATCATGATCGAGCCGCCTGTCCAGCCAGCCGGGGT
R--G--G--V--Y--F--R--V--G--T--Q--P--L--N--P--S--L--M--L--P--A--W--I--M--I--E--P--P--V--Q--P--A--G--V

----------------------------------------------------------------------------------------------------
--S--L--V--S--V--H--S--S--P--N--D--Q--M--L--W--V--L--D--S--R--W--N--V--H--V--R--T--G--I--T--E--E--M-
CAGCTTGGTCAGCGTCCATTCCAGCCCCAACGACCAGATGCTGTGGGTGCTTGACAGCAGGTGGAACGTGCACGTGCGGACCGGGATCACCGAGGAGATG
:: :::::::::::::::::::::::::::.::::::::::::::::. :: :::::::::::: :::::::::: ::..:.::::::::::::::::::
CACCTTGGTCAGCGTCCATTCCAGCCCCAATGACCAGATGCTGTGGGCCCTGGACAGCAGGTGGCACGTGCACGTCCGAGCTGGGATCACCGAGGAGATG
--T--L--V--S--V--H--S--S--P--N--D--Q--M--L--W--A--L--D--S--R--W--H--V--H--V--R--A--G--I--T--E--E--M-

---------------------------------><-----------------------------------------------------------------
-P--V--G--T--A--W--E--H--V--P--G--L--Q--A--C--Q--L--A--L--S--T--R--T--V--W--A--R--C--P--N--G--D--L--
CCTGTGGGGACCGCCTGGGAGCATGTGCCAGGGTTGCAGGCCTGCCAGCTGGCGCTGAGCACCAGGACCGTGTGGGCCCGCTGTCCAAACGGAGACCTCG
:: ::::: :::. ::::::::::::::::   :::::::::::::::::.:: ::::::.:::::::.::::::::::::::.:: :::::.:::::.:
CCAGTGGGCACCAACTGGGAGCATGTGCCA---TTGCAGGCCTGCCAGCTAGCCCTGAGCGCCAGGACTGTGTGGGCCCGCTGCCCCAACGGGGACCTTG
-P--V--G--T--N--W--E--H--V--P-----L--Q--A--C--Q--L--A--L--S--A--R--T--V--W--A--R--C--P--N--G--D--L--

----------------------------------------------------------------------------------><----------------
A--R--R--Y--G--V--T--D--K--N--P--A--G--D--Y--W--K--K--I--P--G--S--V--S--C--F--T--T--A--S--D--E--L--W
CCCGGCGGTACGGCGTCACAGACAAGAACCCCGCCGGGGACTACTGGAAGAAAATTCCCGGCAGCGTGTCGTGTTTCACAACTGCGTCAGATGAGCTGTG
::::.:::::::::::::: ::::::::::: :::::.::::::::::::::.::.::.:: :.:::: :.::.::::::::. ::::.:::::::::::
CCCGACGGTACGGCGTCACCGACAAGAACCCGGCCGGAGACTACTGGAAGAAGATCCCTGGAAACGTGACATGCTTCACAACCTCGTCGGATGAGCTGTG
A--R--R--Y--G--V--T--D--K--N--P--A--G--D--Y--W--K--K--I--P--G--N--V--T--C--F--T--T--S--S--D--E--L--W

----------------------------------------------------------------------------------------------------
--A--V--G--P--P--G--Y--L--L--Q--R--L--T--K--T--F--S--H--S--H--G--T--Q--K--S--S--Q--A--A--M--P--H--P-
GGCTGTGGGCCCGCCCGGCTACCTCCTCCAACGGCTGACAAAGACGTTCAGCCACTCGCACGGCACCCAGAAGAGCAGCCAGGCCGCCATGCCCCACCCT
::: :::::::: :::::::::::::::::.::::::::::.::: ::::::: .:: :::.:..:::::   :::::::: ::::::.  :: :::::.
GGCAGTGGGCCCCCCCGGCTACCTCCTCCAGCGGCTGACAAGGACTTTCAGCCCTTCCCACAGTGCCCAG---AGCAGCCACGCCGCCGGCCCGCACCCC
--A--V--G--P--P--G--Y--L--L--Q--R--L--T--R--T--F--S--P--S--H--S--A--Q-----S--S--H--A--A--G--P--H--P-

---------------------------------
-E--D--L--E--D--E--W--E--V--I--*-
GAGGACCTGGAGGACGAGTGGGAGGTCATCTGA
:::::::::::::::::::::::::::::::::
GAGGACCTGGAGGACGAGTGGGAGGTCATCTGA
-E--D--L--E--D--E--W--E--V--I--*-

Pig Consensus Sequence

>BGISUST0000880500
------------------------------------------------------------------------------------------------TCCG
TGCTGGTccTCACGGCCCTCGACGCCAACGGGGACTACATCGCCGTGGGCAGCAGCGTCGGGATGCTCTACCTGTACTTGCGCCACCTCGACCGGATGAA
GAAGTACAACTGCGAGGGGAAAACGGAGTCCATCACGGTGGTGAAGCTGCTGAGCTGCTTTGACGACCTTGTGGCTGCAGGCACGGCCTCTGGGAGGGTT
GCCGTCTTTCAGCTCGTGTCGTCCTTGCCGGGGAGAAATAAACAG-------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
-----------------GAGCAGCCTGCACGGGACCAGGTGGTGACGTCCAGCGACGAGGAGGACATCTATGCCCAGGGGCTTCCCTCCTCGTCCTCCGA
GACTAGCGTGGCGGAGCTGGGCGCTGGCCGCTCCCTGCAGGACCTGAGCCGGCCCGGTCCAGAGGATCCCGGGCTGCTCAAGTCAGATCAG---------
------------------------------------------------------GAGAAGTACGTCTGGTGTCTGGACTACAAAGGCGGCCTGTTCTGCA
GCGCGCTGCCGGGGGCCGGGCTGCGCTGGCAGAGGTTTGAAGATGCCGTCCAGCAGGTGGCAGTCTCCCCCTCA---GCCCTTCTCTGGAAGATTGAGCA
GAAATCCAACCGCGCCTTTGCTTGTGGAAAAGTGACCATCAAGGGGAAGCGTCACTGGTACGAAGCTCTGCCCCAGGCGGTGTTCGTGGCCCTGAGCGAC
GACACGGCCTGGATCATCAGGACAAACGGAGACCTGTACCTGCAGACA---CTCAGCGTGGATCGCCCCTGCCCCAGGGCCGAAAAGATCGACTGTCCGT
ACCCACTGTCCCAGGTCACAGCCCGAAACAGCGTGGTGTGGGCGCTGACGGATCAAAGAGCGCTCCTGTACCGGGAGGGCGTGAGCAGCTTCTGCCCCGA
GGGGGAGCAGTGGAAATGTGACATTATC------------------------------------------------CAGACGCTGTGGGCCCTGGACATC
CGGGGCAACCTGTGGTTCAGAACTGGCATCGTGTCCAAGAAGCCCCAAGGAGACGACGACCACTGGTGG---GTGAGCATCACAGACTACGTGGTATTCG
ACCAGTGCAGCTTGTTCCAGACCATAATCCACGCCACACACTCGGTGGCCACAGCGGCCCAGGTGCCTGTCGAAAAGGTGGCGGATAAACTGCGCATGGC
GTTTTGGTCTCAGCAGCTTCAGTGCCAGCCGAGCCTGCTCGGGGTCAACAGCAGTGGCGTCTGGATCTCCTCTGGCAAGAACGAATTCCACGTGGCTAAA
GGAAGTCTC------ACTTACTGGAATAACGTTGTTCCCCGTGGGACGGCCTCTGCAACAAAATGGGCCTTTGTGCTGGCTTCCACCGCTCCCACCAAGG
AA---------CTGTGGCTGAGCCAGAGCAGCAAGGACCTGTACAGCATCAGCGCCCAGCACGCCTGGTCCCGCCCGTCCACCGTGCAGCTGCCTCCCGA
TGCCGAGATGAGGGCCTACGCTGCCTGCCAAGATGCCCTGTGGGCCCTGGACAGCCTGGGCCAGGTGTTCATCAAGACGCTGTCCAGGAGCTGCCCCACG
GGCATGCACTGGACGAGGCTGGACCTTTCCCAGCTA---ACCGTAAGACTGACGAGCTTGTCGTGTGGAAACCAGCACGTCTGGGCCTGCGACTCCAGGG
GTGGCGTTTACTTCCGTGTAGGAACGCAGCCTCTGAACCCCAGTCTGATGCTTCCGGCCTGGATCATGATCGAGCCGCCTGTCCAGCCAGCCGGGGTCAC
CTTGGTCAGCGTCCATTCCAGCCCCAATGACCAGATGCTGTGGGCCCTGGACAGCAGGTGGCACGTGCACGTCCGAGCTGGGATCACCGAGGAGATGCCA
GTGGGCACCAACTGGGAGCATGTGCCA---TTGCAGGCCTGCCAGCTAGCCCTGAGCGCCAGGACTGTGTGGGCCCGCTGCCCCAACGGGGACCTTGCCC
GACGGTACGGCGTCACCGACAAGAACCCGGCCGGAGACTACTGGAAGAAGATCCCTGGAAACGTGACATGCTTCACAACCTCGTCGGATGAGCTGTGGGC
AGTGGGCCCCCCCGGCTACCTCCTCCAGCGGCTGACAAGGACTTTCAGCCCTTCCCACAGTGCCCAGAGCAGCCACGCCGCCGGCCCGCACCCCGAGGAC
CTGGAGGACGAGTGGGAGGTCATCTGA


>BGISUSP0000880500
--------------------------------SVLVLTALDANGDYIAVGSSVGMLYLYLRHLDRMKKYNCEGKTESITVVKLLSCFDDLVAAGTASGRV
AVFQLVSSLPGRNKQ-------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
---------------------------------------EQPARDQVVTSSDEEDIYAQGLPSSSSETSVAELGAGRSLQDLSRPGPEDPGLLKSDQ---
------------------EKYVWCLDYKGGLFCSALPGAGLRWQRFEDAVQQVAVSPS-ALLWKIEQKSNRAFACGKVTIKGKRHWYEALPQAVFVALSD
DTAWIIRTNGDLYLQT-LSVDRPCPRAEKIDCPYPLSQVTARNSVVWALTDQRALLYREGVSSFCPEGEQWKCDII----------------QTLWALDI
RGNLWFRTGIVSKKPQGDDDHWW-VSITDYVVFDQCSLFQTIIHATHSVATAAQVPVEKVADKLRMAFWSQQLQCQPSLLGVNSSGVWISSGKNEFHVAK
GSL--TYWNNVVPRGTASATKWAFVLASTAPTKE---LWLSQSSKDLYSISAQHAWSRPSTVQLPPDAEMRAYAACQDALWALDSLGQVFIKTLSRSCPT
GMHWTRLDLSQL-TVRLTSLSCGNQHVWACDSRGGVYFRVGTQPLNPSLMLPAWIMIEPPVQPAGVTLVSVHSSPNDQMLWALDSRWHVHVRAGITEEMP
VGTNWEHVP-LQACQLALSARTVWARCPNGDLARRYGVTDKNPAGDYWKKIPGNVTCFTTSSDELWAVGPPGYLLQRLTRTFSPSHSAQSSHAAGPHPED
LEDEWEVI*