Sequences
EST Library Info
cad1Unavailable
cbl2Blood
cov1Ovary - RNA from China
csk1Skin - RNA from China
dbla1Unavailable
ecc3Foetus 50 days, cortex cerebri
eep1Foetus 50 days, epidermis
eje1Foetus 50 days, jejunum
elu1Foetus 50 days, lung
eye3Foetus 50 days, Eye
fat1Fatt
fbs1Unavailable
jej2Small intestine, jejunum
lin1Large intestine
lnt2Lymphatic nodule tracheobroncalis
mcp2Mammae, collostrum producing
med2Mediastinum
mgp2Mammary gland - 7 days pre birth
nbm3Newborn 115 days, bone marrow (pelvis)
nca1Newborn 115 days, cartillage
nmm2Newborn 115 days, mucosal membranes
pfco1Unavailable
pgl1Pituitary gland
pigca2Unavailable
pigcb1Unavailable
pliv1Unavailable
plun2Unavailable
rec1Rectum
ret1Retina
sin4Small intestine
ski3Skin
spc1Spinal cord
spl3Spleen
ssp2M. Supraspinatus
ton2Tip of tongue, mucosal membrane
tra1Trachea
vin1M. Vastus intermedius
Clusters
Oligos
SNPs

Gene ID ENSG00000197451 (click for geneview)
Transcript ID ENST00000359535(link to ensembl)
Symbol HNRPAB
Localtion Chromosome:5:177564114:177570768:1 band: 5q35.3
Description Heterogeneous nuclear ribonucleoprotein A/B (hnRNP A/B) (APOBEC-1 binding protein 1) (ABBP-1). [Source:Uniprot/SWISSPROT;Acc:Q99729]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<-------------------------------------------------------------------------------><------------------
-M--S--E--A--G--E--E--Q--P--M--E--T--T--G--A--T--E--N--G--H--E--A--V--P--E--G--E--G--R--G--W--H--G--
ATGTCGGAAGCGGGCGAGGAGCAGCCCATGGAGACGACGGGCGCCACCGAGAACGGACATGAGGCCGTCCCCGAAGGCGAGGGCCGGGGCTGGCACGGGC
::::::::::::::.::.::::::::::::::::: :::::::::::::::::::::::.:::::::.:::::::::::::                   
ATGTCGGAAGCGGGTGAAGAGCAGCCCATGGAGACCACGGGCGCCACCGAGAACGGACACGAGGCCGCCCCCGAAGGCGAG-------------------
-M--S--E--A--G--E--E--Q--P--M--E--T--T--G--A--T--E--N--G--H--E--A--A--P--E--G--E--------------------

----><-------------------------------------------------><------------------------------------><-----
R--R--G--L--E--A--R--P--R--R--P--R--A--G--I--R--T--A--P--D--Q--I--N--A--S--K--N--E--E--D--A--G--K--M
GCCGCGGGCTGGAGGCGCGACCGCGGCGCCCCCGAGCGGGAATCAGAACGGCGCCGGACCAGATCAACGCCAGCAAGAACGAGGAGGACGCGGGAAAAAT
                                                        ::::::::::::::::::::::::::.:::::::::   :::::
--------------------------------------------------------GACCAGATCAACGCCAGCAAGAACGAAGAGGACGCG---AAAAT
---------------------------------------------------------D--Q--I--N--A--S--K--N--E--E--D--A-----K--M

----------------------------------------------------------------------------------------------------
--F--V--G--G--L--S--W--D--T--S--K--K--D--L--K--D--Y--F--T--K--F--G--E--V--V--D--C--T--I--K--M--D--P-
GTTCGTTGGTGGCCTGAGCTGGGATACTAGCAAAAAAGATTTAAAAGACTATTTTACTAAATTTGGAGAGGTCGTTGACTGTACAATAAAAATGGATCCC
:::::::::::::::::::::::::::.::::::::.::..::::.::.::::::::.::::::::::::::::::::::::::::::::::::::::::
GTTCGTTGGTGGCCTGAGCTGGGATACCAGCAAAAAGGACCTAAAGGATTATTTTACCAAATTTGGAGAGGTCGTTGACTGTACAATAAAAATGGATCCC
--F--V--G--G--L--S--W--D--T--S--K--K--D--L--K--D--Y--F--T--K--F--G--E--V--V--D--C--T--I--K--M--D--P-

--------------------------------------------------------------><------------------------------------
-N--T--G--R--S--R--G--F--G--F--I--L--F--K--D--A--A--S--V--E--K--V--L--D--Q--K--E--H--R--L--D--G--R--
AACACTGGACGGTCAAGAGGGTTTGGGTTTATCCTGTTCAAAGATGCAGCCAGTGTGGAGAAGGTCCTAGACCAGAAGGAGCACAGGCTGGATGGCCGTG
:::::::: :::::::::::::::::::::::::: :::::::::::::::::::::::::::::.::::::::::::::::::::::::::::::::::
AACACTGGCCGGTCAAGAGGGTTTGGGTTTATCCTCTTCAAAGATGCAGCCAGTGTGGAGAAGGTTCTAGACCAGAAGGAGCACAGGCTGGATGGCCGTG
-N--T--G--R--S--R--G--F--G--F--I--L--F--K--D--A--A--S--V--E--K--V--L--D--Q--K--E--H--R--L--D--G--R--

----------------------------------------------------------------------------------------------------
V--I--D--P--K--K--A--M--A--M--K--K--D--P--V--K--K--I--F--V--G--G--L--N--P--E--A--T--E--E--K--I--R--E
TCATTGACCCTAAAAAGGCCATGGCTATGAAGAAGGACCCGGTGAAGAAAATCTTCGTTGGGGGTCTGAATCCTGAAGCCACTGAGGAAAAGATCAGGGA
::::::::::.:::::::::::::: ::::::::.:::::.::.::::::::.::.:: ::::::::::::::::::::::: :::::.:::::::::::
TCATTGACCCCAAAAAGGCCATGGCAATGAAGAAAGACCCAGTAAAGAAAATTTTTGTAGGGGGTCTGAATCCTGAAGCCACAGAGGAGAAGATCAGGGA
V--I--D--P--K--K--A--M--A--M--K--K--D--P--V--K--K--I--F--V--G--G--L--N--P--E--A--T--E--E--K--I--R--E

---------------------><-----------------------------------------------------------------------------
--Y--F--G--E--F--G--E--I--E--A--I--E--L--P--M--D--P--K--L--N--K--R--R--G--F--V--F--I--T--F--K--E--E-
GTACTTTGGCGAGTTTGGGGAGATTGAGGCCATTGAATTGCCAATGGATCCAAAGTTGAACAAAAGACGAGGTTTTGTGTTTATCACCTTTAAAGAAGAA
::::::::::::.::::::::::::::.:: ::::::.: ::::::::::::::::.:::::::::::::::.::::: ::.:::::::::::::::::.
GTACTTTGGCGAATTTGGGGAGATTGAAGCAATTGAACTTCCAATGGATCCAAAGTCGAACAAAAGACGAGGCTTTGTCTTCATCACCTTTAAAGAAGAG
--Y--F--G--E--F--G--E--I--E--A--I--E--L--P--M--D--P--K--S--N--K--R--R--G--F--V--F--I--T--F--K--E--E-

-----------------------------------------------------><---------------------------------------------
-E--P--V--K--K--V--L--E--K--K--F--H--T--V--S--G--S--K--C--E--I--K--V--A--Q--P--K--E--V--Y--Q--Q--Q--
GAACCCGTGAAGAAGGTTCTGGAGAAAAAGTTCCATACTGTCAGTGGAAGCAAGTGTGAGATCAAGGTGGCCCAGCCCAAAGAAGTCTATCAGCAGCAGC
:::::.::::::::.:::.:::::::.:::::.::.::..:::::::::::::::::::.:::::::::::.:::::::::::.::.:::::.:::::::
GAACCTGTGAAGAAAGTTTTGGAGAAGAAGTTTCACACCATCAGTGGAAGCAAGTGTGAAATCAAGGTGGCTCAGCCCAAAGAGGTTTATCAACAGCAGC
-E--P--V--K--K--V--L--E--K--K--F--H--T--I--S--G--S--K--C--E--I--K--V--A--Q--P--K--E--V--Y--Q--Q--Q--

-----------------------------------------------------------------------><---------------------------
Q--Y--G--S--G--G--R--G--N--R--N--R--G--N--R--G--S--G--G--G--G--G--G--G--G--Q--S--Q--S--W--N--Q--G--Y
AGTATGGCTCTGGGGGCCGTGGAAACCGCAACCGAGGGAACCGAGGCAGCGGAGGTGGTGGTGGAGGTGGAGGTCAGAGTCAGAGTTGGAATCAGGGCTA
::::::::::::::::::::::.::.:::::::::::::::::::::::::: ::::::::.:::.:::::   ::::::::::::::::::::::::::
AGTATGGCTCTGGGGGCCGTGGGAATCGCAACCGAGGGAACCGAGGCAGCGGTGGTGGTGGCGGAAGTGGA---CAGAGTCAGAGTTGGAATCAGGGCTA
Q--Y--G--S--G--G--R--G--N--R--N--R--G--N--R--G--S--G--G--G--G--G--S--G-----Q--S--Q--S--W--N--Q--G--Y

----------------------------------------------------------------------------------------------------
--G--N--Y--W--N--Q--G--Y--G--Y--Q--Q--G--Y--G--P--G--Y--G--G--Y--D--Y--S--P--Y--G--Y--Y--G--Y--G--P-
CGGCAACTACTGGAACCAGGGCTACGGCTACCAGCAGGGCTACGGGCCTGGCTATGGCGGCTACGACTACTCGCCCTATGGCTATTACGGCTACGGCCCC
:::::.::::::::::::::::::::::::::::::::::::::::::.:::::::::::::::::::::::::::::::::::::::::::::::::::
CGGCAGCTACTGGAACCAGGGCTACGGCTACCAGCAGGGCTACGGGCCCGGCTATGGCGGCTACGACTACTCGCCCTATGGCTATTACGGCTACGGCCCC
--G--S--Y--W--N--Q--G--Y--G--Y--Q--Q--G--Y--G--P--G--Y--G--G--Y--D--Y--S--P--Y--G--Y--Y--G--Y--G--P-

------------><--------------------------------------------------------------------->
-G--Y--D--Y--S--Q--G--S--T--N--Y--G--K--S--Q--R--R--G--G--H--Q--N--N--Y--K--P--Y--*-
GGCTACGACTACAGTCAGGGTAGTACAAACTACGGCAAGAGCCAGCGACGTGGTGGCCATCAGAATAACTACAAGCCATACTGA
::::::::::::      :::::::::::.::::: ::::::::::::::::::::::::::::::::::::::::::::::::
GGCTACGACTAC------GGTAGTACAAATTACGGGAAGAGCCAGCGACGTGGTGGCCATCAGAATAACTACAAGCCATACTGA
-G--Y--D--Y--------G--S--T--N--Y--G--K--S--Q--R--R--G--G--H--Q--N--N--Y--K--P--Y--*-

Pig Consensus Sequence

>BGISUST0000900670
ATGTCGGAAGCGGGTGAAGAGCAGCCCATGGAGACCACGGGCGCCACCGAGAACGGACACGAGGCCGCCCCCGAAGGCGAG-------------------
--------------------------------------------------------GACCAGATCAACGCCAGCAAGAACGAAGAGGACGCG---AAAAT
GTTCGTTGGTGGCCTGAGCTGGGATACCAGCAAAAAGGACCTAAAGGATTATTTTACCAAATTTGGAGAGGTCGTTGACTGTACAATAAAAATGGATCCC
AACACTGGCCGGTCAAGAGGGTTTGGGTTTATCCTCTTCAAAGATGCAGCCAGTGTGGAGAAGGTTCTAGACCAGAAGGAGCACAGGCTGGATGGCCGTG
TCATTGACCCCAAAAAGGCCATGGCAATGAAGAAAGACCCAGTAAAGAAAATTTTTGTAGGGGGTCTGAATCCTGAAGCCACAGAGGAGAAGATCAGGGA
GTACTTTGGCGAATTTGGGGAGATTGAAGCAATTGAACTTCCAATGGATCCAAAGTCGAACAAAAGACGAGGCTTTGTCTTCATCACCTTTAAAGAAGAG
GAACCTGTGAAGAAAGTTTTGGAGAAGAAGTTTCACACCATCAGTGGAAGCAAGTGTGAAATCAAGGTGGCTCAGCCCAAAGAGGTTTATCAACAGCAGC
AGTATGGCTCTGGGGGCCGTGGGAATCGCAACCGAGGGAACCGAGGCAGCGGTGGTGGTGGCGGAAGTGGA---CAGAGTCAGAGTTGGAATCAGGGCTA
CGGCAGCTACTGGAACCAGGGCTACGGCTACCAGCAGGGCTACGGGCCCGGCTATGGCGGCTACGACTACTCGCCCTATGGCTATTACGGCTACGGCCCC
GGCTACGACTAC------GGTAGTACAAATTACGGGAAGAGCCAGCGACGTGGTGGCCATCAGAATAACTACAAGCCATACTGA


>BGISUSP0000900670
MSEAGEEQPMETTGATENGHEAAPEGE-------------------------DQINASKNEEDA-KMFVGGLSWDTSKKDLKDYFTKFGEVVDCTIKMDP
NTGRSRGFGFILFKDAASVEKVLDQKEHRLDGRVIDPKKAMAMKKDPVKKIFVGGLNPEATEEKIREYFGEFGEIEAIELPMDPKSNKRRGFVFITFKEE
EPVKKVLEKKFHTISGSKCEIKVAQPKEVYQQQQYGSGGRGNRNRGNRGSGGGGGSG-QSQSWNQGYGSYWNQGYGYQQGYGPGYGGYDYSPYGYYGYGP
GYDY--GSTNYGKSQRRGGHQNNYKPY*