Sequences
EST Library Info
med3Mediastinum
tes1Testes
Clusters
Oligos
SNPs

Gene ID ENSG00000196950 (click for geneview)
Transcript ID ENST00000359634(link to ensembl)
Symbol SLC39A10
Localtion Chromosome:2:196347445:196427924:1 band: 2q32.3
Description solute carrier family 39 (zinc transporter), member 10 [Source:RefSeq_peptide;Acc:NP_065075]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--K--V--H--M--H--T--K--F--C--L--I--C--L--L--T--F--I--F--H--H--C--N--H--C--H--E--E--H--D--H--G--P--
ATGAAGGTACATATGCACACAAAATTTTGCCTCATTTGTTTGCTGACATTTATTTTTCATCATTGCAACCATTGCCATGAAGAACATGACCATGGCCCTG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
E--A--L--H--R--Q--H--R--G--M--T--E--L--E--P--S--K--F--S--K--Q--A--A--E--N--E--K--K--Y--Y--I--E--K--L
AAGCGCTTCACAGACAGCATCGTGGAATGACAGAATTGGAGCCAAGCAAATTTTCAAAGCAAGCTGCTGAAAATGAAAAAAAATACTATATTGAAAAACT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--F--E--R--Y--G--E--N--G--R--L--S--F--F--G--L--E--K--L--L--T--N--L--G--L--G--E--R--K--V--V--E--I--N-
TTTTGAGCGTTATGGTGAAAATGGAAGATTATCCTTTTTTGGTTTGGAGAAACTTTTAACAAACTTGGGCCTTGGAGAGAGAAAAGTAGTTGAGATTAAT
                                                                                              ::::::
----------------------------------------------------------------------------------------------ATTAAT
-----------------------------------------------------------------------------------------------I--N-

----------------------------------------------------------------------------------------------------
-H--E--D--L--G--H--D--H--V--S--H--L--D--I--L--A--V--Q--E--G--K--H--F--H--S--H--N--H--Q--H--S--H--N--
CATGAGGATCTTGGCCACGATCATGTTTCTCATTTAGATATTTTGGCAGTTCAAGAGGGAAAGCATTTTCACTCACATAACCACCAGCATTCCCATAATC
::::::::::::::::::::::::::::::::.:::::::::::::::::::::::::::::::::::::::::::::::.:::::::::::::::::::
CATGAGGATCTTGGCCACGATCATGTTTCTCACTTAGATATTTTGGCAGTTCAAGAGGGAAAGCATTTTCACTCACATAATCACCAGCATTCCCATAATC
-H--E--D--L--G--H--D--H--V--S--H--L--D--I--L--A--V--Q--E--G--K--H--F--H--S--H--N--H--Q--H--S--H--N--

----------------------------------------------------------------------------------------------------
H--L--N--S--E--N--Q--T--V--T--S--V--S--T--K--R--N--H--K--C--D--P--E--K--E--T--V--E--V--S--V--K--S--D
ATTTAAATTCAGAAAATCAAACTGTGACCAGTGTATCCACAAAAAGAAACCATAAATGTGATCCAGAGAAAGAGACAGTTGAAGTGTCTGTAAAATCTGA
::::::::::::::::::::::::::::::::.:::: :::::::::::::::::.::::::::::::::::::::..::::: ::::::: ::::::::
ATTTAAATTCAGAAAATCAAACTGTGACCAGTATATCAACAAAAAGAAACCATAAGTGTGATCCAGAGAAAGAGACGATTGAACTGTCTGTCAAATCTGA
H--L--N--S--E--N--Q--T--V--T--S--I--S--T--K--R--N--H--K--C--D--P--E--K--E--T--I--E--L--S--V--K--S--D

----------------------------------------------------------------------------------------------------
--D--K--H--M--H--D--H--N--H--R--L--R--H--H--H--R--L--H--H--H--L--D--H--N--N--T--H--H--F--H--N--D--S-
TGATAAACATATGCATGACCATAATCACCGCCTACGTCATCACCATCGTTTGCATCATCATCTTGATCATAACAACACTCACCATTTTCATAATGATTCC
::::::::::::..::::::.::::::.::::::.:::::::::::.::::::.::::::.::.:::::::::: .::::.:::::::: ::::::::::
TGATAAACATATATATGACCGTAATCATCGCCTATGTCATCACCATTGTTTGCGTCATCACCTCGATCATAACACTACTCGCCATTTTCCTAATGATTCC
--D--K--H--I--Y--D--R--N--H--R--L--C--H--H--H--C--L--R--H--H--L--D--H--N--T--T--R--H--F--P--N--D--S-

----------------------------------------------------------------------------------------------------
-I--T--P--S--E--R--G--E--P--S--N--E--P--S--T--E--T--N--K--T--Q--E--Q--S--D--V--K--L--P--K--G--K--R--
ATTACTCCCAGTGAGCGTGGGGAGCCTAGCAATGAACCTTCAACAGAGACCAATAAAACCCAGGAACAATCTGATGTTAAACTACCGAAAGGAAAGAGGA
::::::: :::::::::::::::::::::: :::::::::::::::::::::::::::: :::::.:::::::: . :::. :.   :::::::::::::
ATTACTCACAGTGAGCGTGGGGAGCCTAGCCATGAACCTTCAACAGAGACCAATAAAACACAGGAGCAATCTGAAAGTAAGATG---AAAGGAAAGAGGA
-I--T--H--S--E--R--G--E--P--S--H--E--P--S--T--E--T--N--K--T--Q--E--Q--S--E--S--K--M-----K--G--K--R--

----------------------------------------------------------------------------------------------------
K--K--K--G--R--K--S--N--E--N--S--E--V--I--T--P--G--F--P--P--N--H--D--Q--G--E--Q--Y--E--H--N--R--V--H
AGAAAAAAGGGAGGAAAAGTAATGAAAATTCTGAGGTTATTACACCAGGTTTTCCCCCTAACCATGATCAGGGTGAACAGTATGAGCATAATCGGGTCCA
:::.::::::::.:::::::::::::::::::::::::::::::::::::::::::::::::  :::::::::.::::::::::::::::::::::::::
AGAGAAAAGGGAAGAAAAGTAATGAAAATTCTGAGGTTATTACACCAGGTTTTCCCCCTAACATTGATCAGGGCGAACAGTATGAGCATAATCGGGTCCA
K--R--K--G--K--K--S--N--E--N--S--E--V--I--T--P--G--F--P--P--N--I--D--Q--G--E--Q--Y--E--H--N--R--V--H

----------------------------------------------------------------------------------------------------
--K--P--D--R--V--H--N--P--G--H--S--H--V--H--L--P--E--R--N--G--H--D--P--G--R--G--H--Q--D--L--D--P--D-
CAAACCTGATCGTGTACATAACCCAGGTCATTCTCATGTACATCTTCCAGAACGTAATGGTCATGATCCTGGTCGTGGACACCAAGATCTTGATCCTGAT
:::::::::::::::::::::::::::.:::::::::::::.:::::::::::.::::::::::::::::::::.:::::::::::::::::::::::::
CAAACCTGATCGTGTACATAACCCAGGCCATTCTCATGTACGTCTTCCAGAACATAATGGTCATGATCCTGGTCATGGACACCAAGATCTTGATCCTGAT
--K--P--D--R--V--H--N--P--G--H--S--H--V--R--L--P--E--H--N--G--H--D--P--G--H--G--H--Q--D--L--D--P--D-

----------------------------------------------------------------------------------------------------
-N--E--G--E--L--R--H--T--R--K--R--E--A--P--H--V--K--N--N--A--I--I--S--L--------R--K--D--L--N--E--D--
AATGAAGGTGAACTTCGACATACTAGAAAGAGAGAAGCACCACATGTTAAAAATAATGCAATAATTTCTTTG------AGAAAAGATCTAAATGAAGATG
:::::::::::::::::::::::::::::::::::::::::.::::::::::: :.::::::   :::  .        . :::::::  ::::::::::
AATGAAGGTGAACTTCGACATACTAGAAAGAGAGAAGCACCGCATGTTAAAAAAAGTGCAATTTATTCAGCTGCTAGTCACAAAGATCATAATGAAGATG
-N--E--G--E--L--R--H--T--R--K--R--E--A--P--H--V--K--K--S--A--I--Y--S--A--A--S--H--K--D--H--N--E--D--

-------------><-------------------------------------------------------------------------------------
D--H--H--H--E--C--L--N--V--T--Q--L--L--K--Y--Y--G--H--G--A--N--S--P--I--S--T--D--L--F--T--Y--L--C--P
ACCATCATCATGAATGTTTGAACGTCACTCAGTTATTAAAATACTATGGTCATGGTGCCAACTCTCCCATCTCAACTGATTTATTTACATACCTTTGCCC
:::. :: :::   ::::::::::::::::::::.:::::::::::::::::::::::::::::::: :::::: :::::.:::::::::::::::::::
ACCGGCAACAT---TGTTTGAACGTCACTCAGTTGTTAAAATACTATGGTCATGGTGCCAACTCTCCAATCTCACCTGATCTATTTACATACCTTTGCCC
D--R--Q--H-----C--L--N--V--T--Q--L--L--K--Y--Y--G--H--G--A--N--S--P--I--S--P--D--L--F--T--Y--L--C--P

----------------------------------------------------------------------------------------------------
--A--L--L--Y--Q--I--D--S--R--L--C--I--E--H--F--D--K--L--L--V--E--D--I--N--K--D--K--N--L--V--P--E--D-
TGCATTGTTATATCAAATCGACAGCAGACTTTGTATTGAGCATTTTGACAAACTTTTAGTTGAAGATATAAATAAGGATAAAAACCTGGTTCCTGAAGAT
::: ::.:::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::.:::::::::::::::
TGCTTTATTATATCAAATCGACAGCAGACTTTGTATTGAGCATTTTGACAAACTTTTAGTTGAAGATATAAATAAGGATAAAAATCTGGTTCCTGAAGAT
--A--L--L--Y--Q--I--D--S--R--L--C--I--E--H--F--D--K--L--L--V--E--D--I--N--K--D--K--N--L--V--P--E--D-

---------------------><-----------------------------------------------------------------------------
-E--A--N--I--G--A--S--A--W--I--C--G--I--I--S--I--T--V--I--S--L--L--S--L--L--G--V--I--L--V--P--I--I--
GAGGCAAATATAGGGGCATCAGCCTGGATTTGTGGTATCATTTCTATCACTGTCATTAGCCTGCTTTCCTTGCTAGGCGTGATCTTGGTTCCTATCATTA
.::::::::::::::::::::   :::::::::::::::::::::::::::::.::::::::::::::::::::::::::::::::::::::.:::::::
AAGGCAAATATAGGGGCATCA---TGGATTTGTGGTATCATTTCTATCACTGTTATTAGCCTGCTTTCCTTGCTAGGCGTGATCTTGGTTCCCATCATTA
-K--A--N--I--G--A--S-----W--I--C--G--I--I--S--I--T--V--I--S--L--L--S--L--L--G--V--I--L--V--P--I--I--

-------------------------------------------------------------------------------------------><-------
N--Q--G--C--F--K--F--L--L--T--F--L--V--A--L--A--V--G--T--M--S--G--D--A--L--L--H--L--L--P--H--S--Q--G
ACCAAGGATGCTTCAAATTCCTTCTTACATTCCTTGTTGCATTAGCTGTAGGAACAATGAGTGGAGACGCCCTTCTTCATCTACTGCCCCATTCTCAGGG
:::::::::::::::::::::::::.:::::::::::::::.:::::::::::::::::::::::::.::::::::::::::::::::::::::::::::
ACCAAGGATGCTTCAAATTCCTTCTCACATTCCTTGTTGCACTAGCTGTAGGAACAATGAGTGGAGATGCCCTTCTTCATCTACTGCCCCATTCTCAGGG
N--Q--G--C--F--K--F--L--L--T--F--L--V--A--L--A--V--G--T--M--S--G--D--A--L--L--H--L--L--P--H--S--Q--G

----------------------------------------------------------------------------------------------------
--G--H--D--H--S--H--Q--H--A--H--G--H--G--H--S--H--G--H--E--S--N--K--F--L--E--E--Y--D--A--V--L--K--G-
TGGACATGATCACAGTCACCAACATGCACATGGGCATGGACATTCTCATGGACATGAATCTAACAAGTTTTTGGAAGAATATGATGCTGTATTGAAAGGA
::::::::::::.:::::.:::::::::::::::::::::::::::::::::::::::::::: ::::::.:.:::::::::::::::::.:::::::::
TGGACATGATCATAGTCATCAACATGCACATGGGCATGGACATTCTCATGGACATGAATCTAAGAAGTTTCTAGAAGAATATGATGCTGTGTTGAAAGGA
--G--H--D--H--S--H--Q--H--A--H--G--H--G--H--S--H--G--H--E--S--K--K--F--L--E--E--Y--D--A--V--L--K--G-

--------------------------------------------------------------------------------><------------------
-L--V--A--L--G--G--I--Y--L--L--F--I--I--E--H--C--I--R--M--F--K--H--Y--K--Q--Q--R--G--K--Q--K--W--F--
CTTGTTGCTCTAGGAGGCATTTACTTGCTATTTATCATTGAACACTGCATTAGAATGTTTAAGCACTACAAACAACAAAGAGGAAAACAGAAATGGTTTA
:::.:::::::::::::::::::.:::.::::::::::.:::::.:::::::::::::::::::::::::::::.::::::                   
CTTATTGCTCTAGGAGGCATTTATTTGTTATTTATCATCGAACATTGCATTAGAATGTTTAAGCACTACAAACAGCAAAGA-------------------
-L--I--A--L--G--G--I--Y--L--L--F--I--I--E--H--C--I--R--M--F--K--H--Y--K--Q--Q--R--------------------

----------------------------------------------------------------------------------------------------
M--K--Q--N--T--E--E--S--T--I--G--R--K--L--S--D--H--K--L--N--N--T--P--D--S--D--W--L--Q--L--K--P--L--A
TGAAACAGAACACAGAAGAATCAACTATTGGAAGAAAGCTTTCAGATCACAAGTTAAACAATACACCAGATTCTGACTGGCTTCAACTCAAGCCTCTTGC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-><-------------------------------------------------------------------------------------------------
--G--T--D--D--S--V--V--S--E--D--R--L--N--E--T--E--L--T--D--L--E--G--Q--Q--E--S--P--P--K--N--Y--L--C-
CGGAACTGATGACTCGGTTGTTTCTGAAGATCGACTTAATGAAACTGAACTGACAGATTTAGAAGGCCAACAAGAATCCCCTCCTAAAAATTACCTTTGT
    :::::::::::.:::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::.::::::
----ACTGATGACTCAGTTGTTTCTGAAGATCGACTTAATGAAACTGAACTGACAGATTTAGAAGGCCAACAAGAATCCCCTCCTAAAAATTATCTTTGT
-----T--D--D--S--V--V--S--E--D--R--L--N--E--T--E--L--T--D--L--E--G--Q--Q--E--S--P--P--K--N--Y--L--C-

----------------------------------------------------------------------------------------------------
-I--E--E--E--K--I--I--D--H--S--H--S--D--G--L--H--T--I--H--E--H--D--L--H--A--A--A--H--N--H--H--G--E--
ATAGAAGAGGAGAAAATCATAGACCATTCTCACAGTGATGGATTACATACCATTCATGAGCATGATCTCCATGCTGCTGCACATAACCACCACGGCGAGA
::::::::::::::::::::.::::::::::::::::::::::::::..::::::::::::::::::::::::::::::::::.::::::::.:.:::::
ATAGAAGAGGAGAAAATCATGGACCATTCTCACAGTGATGGATTACACGCCATTCATGAGCATGATCTCCATGCTGCTGCACACAACCACCATGACGAGA
-I--E--E--E--K--I--M--D--H--S--H--S--D--G--L--H--A--I--H--E--H--D--L--H--A--A--A--H--N--H--H--D--E--

----------------------------------------------------------------------------------------------------
N--K--T--V--L--R--K--H--N--H--Q--W--H--H--K--H--S--H--H--S--H--G--P--C--H--S--G--S--D--L--K--E--T--G
ACAAAACTGTGCTGAGGAAGCATAATCACCAGTGGCACCACAAGCATTCTCATCATTCCCATGGCCCCTGTCATTCTGGATCCGATCTGAAAGAAACAGG
..:::::::::::::::::::::::::::::::::::::::::.::::::::.::::: ::::: ::::::::::::::::: ::::: ::.::::::::
GTAAAACTGTGCTGAGGAAGCATAATCACCAGTGGCACCACAAACATTCTCACCATTCACATGGGCCCTGTCATTCTGGATCAGATCTTAAGGAAACAGG
S--K--T--V--L--R--K--H--N--H--Q--W--H--H--K--H--S--H--H--S--H--G--P--C--H--S--G--S--D--L--K--E--T--G

----------------------------------------------------------------------><----------------------------
--I--A--N--I--A--W--M--V--I--M--G--D--G--I--H--N--F--S--D--G--L--A--I--G--A--A--F--S--A--G--L--T--G-
AATAGCTAATATAGCCTGGATGGTGATCATGGGGGATGGCATCCACAACTTCAGTGATGGGCTCGCAATTGGTGCAGCTTTCAGTGCTGGATTGACAGGA
:::::::::::: ::.::::::::.::::::::::::::::::::::::::::::::::: .: ::::::   :::::::::::: :.::::::::.:::
AATAGCTAATATTGCTTGGATGGTAATCATGGGGGATGGCATCCACAACTTCAGTGATGGTTTAGCAATT---GCAGCTTTCAGTTCCGGATTGACGGGA
--I--A--N--I--A--W--M--V--I--M--G--D--G--I--H--N--F--S--D--G--L--A--I-----A--A--F--S--S--G--L--T--G-

---------------------------------------------------><-----------------------------------------------
-G--I--S--T--S--I--A--V--F--C--H--E--L--P--H--E--L--G--D--F--A--V--L--L--K--A--G--M--T--V--K--Q--A--
GGAATCAGTACTTCTATAGCCGTCTTCTGTCATGAACTGCCACATGAATTAGGAGATTTTGCAGTTCTTCTTAAAGCAGGCATGACTGTAAAGCAAGCAA
::::::::::::::::::::.::::::::::::::::::::::::::::::   ::::::::::::::::::::::::::::::::::::::::::::.:
GGAATCAGTACTTCTATAGCTGTCTTCTGTCATGAACTGCCACATGAATTA---GATTTTGCAGTTCTTCTTAAAGCAGGCATGACTGTAAAGCAAGCGA
-G--I--S--T--S--I--A--V--F--C--H--E--L--P--H--E--L-----D--F--A--V--L--L--K--A--G--M--T--V--K--Q--A--

----------------------------------------------------------------------------------------------------
I--V--Y--N--L--L--S--A--M--M--A--Y--I--G--M--L--I--G--T--A--V--G--Q--Y--A--N--N--I--T--L--W--I--F--A
TTGTATACAACCTCCTCTCTGCCATGATGGCTTACATAGGCATGCTCATAGGCACAGCTGTTGGTCAGTATGCCAATAACATCACACTTTGGATCTTTGC
::::.:::::::::::.:::::::::::::::::::::::::::::.:::::::::::::::::::::::::::::::::::::: ::::::::::::::
TTGTGTACAACCTCCTTTCTGCCATGATGGCTTACATAGGCATGCTTATAGGCACAGCTGTTGGTCAGTATGCCAATAACATCACCCTTTGGATCTTTGC
I--V--Y--N--L--L--S--A--M--M--A--Y--I--G--M--L--I--G--T--A--V--G--Q--Y--A--N--N--I--T--L--W--I--F--A

------------------------------------------><--------------------------------------------------------
--V--T--A--G--M--F--L--Y--V--A--L--V--D--M--L--P--E--M--L--H--G--D--G--D--N--E--E--H--G--F--C--P--V-
AGTCACTGCAGGCATGTTCCTCTATGTAGCCTTGGTGGATATGCTTCCAGAAATGTTGCATGGTGATGGTGACAATGAAGAACATGGCTTTTGTCCTGTG
:.::::::::::::::::::::::.::::::::::::::::::::::::::::::::::::::::::::::::::::::::.::::::::.::::: :::
AATCACTGCAGGCATGTTCCTCTACGTAGCCTTGGTGGATATGCTTCCAGAAATGTTGCATGGTGATGGTGACAATGAAGAGCATGGCTTCTGTCCAGTG
--I--T--A--G--M--F--L--Y--V--A--L--V--D--M--L--P--E--M--L--H--G--D--G--D--N--E--E--H--G--F--C--P--V-

----------------------------------------------------------------------------------------------------
-G--Q--F--I--L--Q--N--L--G--L--L--F--G--F--A--I--M--L--V--I--A--L--Y--E--D--K--I--V--F--D--I--Q--F--
GGGCAATTCATCCTTCAGAATTTAGGATTGCTCTTTGGATTTGCCATTATGCTGGTGATTGCCCTCTATGAAGATAAAATTGTGTTTGACATCCAGTTTT
:::::.:::::.:::::::::::::::::::: ::::::::::::::.::::::::.:::::::::::::::::.::::::::::::::: :::::::::
GGGCAGTTCATTCTTCAGAATTTAGGATTGCTATTTGGATTTGCCATCATGCTGGTAATTGCCCTCTATGAAGACAAAATTGTGTTTGACCTCCAGTTTT
-G--Q--F--I--L--Q--N--L--G--L--L--F--G--F--A--I--M--L--V--I--A--L--Y--E--D--K--I--V--F--D--L--Q--F--

->
*-
GA
::
GA
*-

Pig Consensus Sequence

>BGISUST0000884341
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------ATTAAT
CATGAGGATCTTGGCCACGATCATGTTTCTCACTTAGATATTTTGGCAGTTCAAGAGGGAAAGCATTTTCACTCACATAATCACCAGCATTCCCATAATC
ATTTAAATTCAGAAAATCAAACTGTGACCAGTATATCAACAAAAAGAAACCATAAGTGTGATCCAGAGAAAGAGACGATTGAACTGTCTGTCAAATCTGA
TGATAAACATATATATGACCGTAATCATCGCCTATGTCATCACCATTGTTTGCGTCATCACCTCGATCATAACACTACTCGCCATTTTCCTAATGATTCC
ATTACTCACAGTGAGCGTGGGGAGCCTAGCCATGAACCTTCAACAGAGACCAATAAAACACAGGAGCAATCTGAAAGTAAGATGAAAGGAAAGAGGAAGA
GAAAAGGGAAGAAAAGTAATGAAAATTCTGAGGTTATTACACCAGGTTTTCCCCCTAACATTGATCAGGGCGAACAGTATGAGCATAATCGGGTCCACAA
ACCTGATCGTGTACATAACCCAGGCCATTCTCATGTACGTCTTCCAGAACATAATGGTCATGATCCTGGTCATGGACACCAAGATCTTGATCCTGATAAT
GAAGGTGAACTTCGACATACTAGAAAGAGAGAAGCACCGCATGTTAAAAAAAGTGCAATTTATTCAGCTGCTAGTCACAAAGATCATAATGAAGATGACC
GG---TGTTTGAACGTCACTCAGTTGTTAAAATACTATGGTCATGGTGCCAACTCTCCAATCTCACCTGATCTATTTACATACCTTTGCCCTGCTTTATT
ATATCAAATCGACAGCAGACTTTGTATTGAGCATTTTGACAAACTTTTAGTTGAAGATATAAATAAGGATAAAAATCTGGTTCCTGAAGATAAGGCAAAT
ATAGGGGCATCA---TGGATTTGTGGTATCATTTCTATCACTGTTATTAGCCTGCTTTCCTTGCTAGGCGTGATCTTGGTTCCCATCATTAACCAAGGAT
GCTTCAAATTCCTTCTCACATTCCTTGTTGCACTAGCTGTAGGAACAATGAGTGGAGATGCCCTTCTTCATCTACTGCCCCATTCTCAGGGTGGACATGA
TCATAGTCATCAACATGCACATGGGCATGGACATTCTCATGGACATGAATCTAAGAAGTTTCTAGAAGAATATGATGCTGTGTTGAAAGGACTTATTGCT
CTAGGAGGCATTTATTTGTTATTTATCATCGAACATTGCATTAGAATGTTTAAGCACTACAAACAGCAAAGA----------------------------
-----------------------------------------------------------------------------------------------ACTGA
TGACTCAGTTGTTTCTGAAGATCGACTTAATGAAACTGAACTGACAGATTTAGAAGGCCAACAAGAATCCCCTCCTAAAAATTATCTTTGTATAGAAGAG
GAGAAAATCATGGACCATTCTCACAGTGATGGATTACACGCCATTCATGAGCATGATCTCCATGCTGCTGCACACAACCACCATGACGAGAGTAAAACTG
TGCTGAGGAAGCATAATCACCAGTGGCACCACAAACATTCTCACCATTCACATGGGCCCTGTCATTCTGGATCAGATCTTAAGGAAACAGGAATAGCTAA
TATTGCTTGGATGGTAATCATGGGGGATGGCATCCACAACTTCAGTGATGGTTTAGCAATT---GCAGCTTTCAGTTCCGGATTGACGGGAGGAATCAGT
ACTTCTATAGCTGTCTTCTGTCATGAACTGCCACATGAATTA---GATTTTGCAGTTCTTCTTAAAGCAGGCATGACTGTAAAGCAAGCGATTGTGTACA
ACCTCCTTTCTGCCATGATGGCTTACATAGGCATGCTTATAGGCACAGCTGTTGGTCAGTATGCCAATAACATCACCCTTTGGATCTTTGCAATCACTGC
AGGCATGTTCCTCTACGTAGCCTTGGTGGATATGCTTCCAGAAATGTTGCATGGTGATGGTGACAATGAAGAGCATGGCTTCTGTCCAGTGGGGCAGTTC
ATTCTTCAGAATTTAGGATTGCTATTTGGATTTGCCATCATGCTGGTAATTGCCCTCTATGAAGACAAAATTGTGTTTGACCTCCAGTTTTGA


>BGISUSP0000884341
--------------------------------------------------------------------------------------------------IN
HEDLGHDHVSHLDILAVQEGKHFHSHNHQHSHNHLNSENQTVTSISTKRNHKCDPEKETIELSVKSDDKHIYDRNHRLCHHHCLRHHLDHNTTRHFPNDS
ITHSERGEPSHEPSTETNKTQEQSESKMKGKRKRKGKKSNENSEVITPGFPPNIDQGEQYEHNRVHKPDRVHNPGHSHVRLPEHNGHDPGHGHQDLDPDN
EGELRHTRKREAPHVKKSAIYSAASHKDHNEDDR-CLNVTQLLKYYGHGANSPISPDLFTYLCPALLYQIDSRLCIEHFDKLLVEDINKDKNLVPEDKAN
IGAS-WICGIISITVISLLSLLGVILVPIINQGCFKFLLTFLVALAVGTMSGDALLHLLPHSQGGHDHSHQHAHGHGHSHGHESKKFLEEYDAVLKGLIA
LGGIYLLFIIEHCIRMFKHYKQQR-----------------------------------------TDDSVVSEDRLNETELTDLEGQQESPPKNYLCIEE
EKIMDHSHSDGLHAIHEHDLHAAAHNHHDESKTVLRKHNHQWHHKHSHHSHGPCHSGSDLKETGIANIAWMVIMGDGIHNFSDGLAI-AAFSSGLTGGIS
TSIAVFCHELPHEL-DFAVLLKAGMTVKQAIVYNLLSAMMAYIGMLIGTAVGQYANNITLWIFAITAGMFLYVALVDMLPEMLHGDGDNEEHGFCPVGQF
ILQNLGLLFGFAIMLVIALYEDKIVFDLQF*