Sequences
EST Library Info
hyp2Hypothalamus
med5Mediastinum
nje1Newborn 115 days, jejunum
plac2Unavailable
Clusters
Oligos
SNPs

Gene ID ENSG00000079805 (click for geneview)
Transcript ID ENST00000359692(link to ensembl)
Symbol NP_004936.2
Localtion Chromosome:19:10689774:10803579:1 band: 19p13.2
Description dynamin 2 isoform 4
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--G--N--R--G--M--E--E--L--I--P--L--V--N--K--L--Q--D--A--F--S--S--I--G--Q--S--C--H--L--D--L--P--Q--
ATGGGCAACCGCGGGATGGAAGAGCTGATCCCGCTGGTCAACAAACTGCAGGACGCCTTCAGCTCCATCGGCCAGAGCTGCCACCTGGACCTGCCGCAGA
                              ::::::::::::::.::::::::.::::::::::::::::::::::::::::::::::::::::::::::
------------------------------CCGCTGGTCAACAAGCTGCAGGATGCCTTCAGCTCCATCGGCCAGAGCTGCCACCTGGACCTGCCGCAGA
-------------------------------P--L--V--N--K--L--Q--D--A--F--S--S--I--G--Q--S--C--H--L--D--L--P--Q--

------------------------------------------------------------><--------------------------------------
I--A--V--V--G--G--Q--S--A--G--K--S--S--V--L--E--N--F--V--G--R--D--F--L--P--R--G--S--G--I--V--T--R--R
TCGCTGTAGTGGGCGGCCAGAGCGCCGGCAAGAGCTCGGTGCTGGAGAACTTCGTGGGCCGGGACTTCCTTCCCCGCGGTTCAGGAATCGTCACCCGGCG
:.::.::.:::::::::::::::::::::::::::::.::::: :::::::::::::::   :::::::::::::: :::::::::::::::::.:::::
TTGCCGTGGTGGGCGGCCAGAGCGCCGGCAAGAGCTCAGTGCTCGAGAACTTCGTGGGC---GACTTCCTTCCCCGAGGTTCAGGAATCGTCACTCGGCG
I--A--V--V--G--G--Q--S--A--G--K--S--S--V--L--E--N--F--V--G-----D--F--L--P--R--G--S--G--I--V--T--R--R

----------------------------------><----------------------------------------------------------------
--P--L--I--L--Q--L--I--F--S--K--T--E--H--A--E--F--L--H--C--K--S--K--K--F--T--D--F--D--E--V--R--Q--E-
GCCTCTCATTCTGCAGCTCATCTTCTCAAAAACAGAACATGCCGAGTTTTTGCACTGCAAGTCCAAAAAGTTTACAGACTTTGATGAAGTCCGGCAGGAG
::::::::::::::::::::::::::::::::::                                       ::::::::     :::::::.::::::
GCCTCTCATTCTGCAGCTCATCTTCTCAAAAACA---------------------------------------ACAGACTTNNNNNAAGTCCGACAGGAG
--P--L--I--L--Q--L--I--F--S--K--T-----------------------------------------T--D--X--X--X--V--R--Q--E-

------------------------------------------------------------------------------------><--------------
-I--E--A--E--T--D--R--V--T--G--T--N--K--G--I--S--P--V--P--I--N--L--R--V--Y--S--P--H--V--L--N--L--T--
ATTGAAGCAGAGACCGACAGGGTCACGGGGACCAACAAAGGCATCTCCCCAGTGCCCATCAACCTTCGAGTCTACTCGCCACACGTGTTGAACTTGACCC
::.:::::.::::::::::::::::::::::::::.:::::::::::::::::::::::::::.: ::.::::::::.::::::   ::::::.::::::
ATCGAAGCGGAGACCGACAGGGTCACGGGGACCAATAAAGGCATCTCCCCAGTGCCCATCAACTTGCGGGTCTACTCACCACAC---TTGAACCTGACCC
-I--E--A--E--T--D--R--V--T--G--T--N--K--G--I--S--P--V--P--I--N--L--R--V--Y--S--P--H-----L--N--L--T--

----------------------------------------------------------------------------------------------------
L--I--D--L--P--G--I--T--K--V--P--V--G--D--Q--P--P--D--I--E--Y--Q--I--K--D--M--I--L--Q--F--I--S--R--E
TCATCGACCTCCCGGGTATCACCAAGGTGCCTGTGGGCGACCAGCCTCCAGACATCGAGTACCAGATCAAGGACATGATCCTGCAGTTCATCAGCCGGGA
:::::::::: :::::.::::::::::::::.::::: ::::::::.:::::::::::::::::::::::::::::::::::::::::::::::::::::
TCATCGACCTGCCGGGCATCACCAAGGTGCCCGTGGGGGACCAGCCCCCAGACATCGAGTACCAGATCAAGGACATGATCCTGCAGTTCATCAGCCGGGA
L--I--D--L--P--G--I--T--K--V--P--V--G--D--Q--P--P--D--I--E--Y--Q--I--K--D--M--I--L--Q--F--I--S--R--E

----------------------------------------------------------------------------------------><----------
--S--S--L--I--L--A--V--T--P--A--N--M--D--L--A--N--S--D--A--L--K--L--A--K--E--V--D--P--Q--G--L--R--T-
GAGCAGCCTCATTCTGGCTGTCACGCCCGCCAACATGGACCTGGCCAACTCCGACGCCCTCAAGCTGGCCAAGGAAGTCGATCCCCAAGGCCTACGGACC
::::::::::::.:: ::.::::: :::::::::::::::::::::::::: :::::::::::::::::::::::.:::::.::.:::   ::.::::::
GAGCAGCCTCATCCTCGCCGTCACCCCCGCCAACATGGACCTGGCCAACTCGGACGCCCTCAAGCTGGCCAAGGAGGTCGACCCTCAA---CTGCGGACC
--S--S--L--I--L--A--V--T--P--A--N--M--D--L--A--N--S--D--A--L--K--L--A--K--E--V--D--P--Q-----L--R--T-

---------------------------------------------------------------------------------------><-----------
-I--G--V--I--T--K--L--D--L--M--D--E--G--T--D--A--R--D--V--L--E--N--K--L--L--P--L--R--R--G--Y--I--G--
ATCGGTGTCATCACCAAGCTTGACCTGATGGACGAGGGCACCGACGCCAGGGACGTCTTGGAGAACAAGTTGCTCCCGTTGAGAAGAGGCTACATTGGCG
::.::.:::::::::::::::::::::::::::::.:::::.::.::::::::.:::.:::::::::::.::::::: :::::::::   ::::::::.:
ATTGGCGTCATCACCAAGCTTGACCTGATGGACGAAGGCACTGATGCCAGGGATGTCCTGGAGAACAAGCTGCTCCCCTTGAGAAGA---TACATTGGTG
-I--G--V--I--T--K--L--D--L--M--D--E--G--T--D--A--R--D--V--L--E--N--K--L--L--P--L--R--R-----Y--I--G--

----------------------------------------------------------------------------------------------------
V--V--N--R--S--Q--K--D--I--E--G--K--K--D--I--R--A--A--L--A--A--E--R--K--F--F--L--S--H--P--A--Y--R--H
TGGTGAACCGCAGCCAGAAGGATATTGAGGGCAAGAAGGACATCCGTGCAGCACTGGCAGCTGAGAGGAAGTTCTTCCTCTCCCACCCGGCCTACCGGCA
::::::::::::::::::::::.::.:::::::::::::::::.:::::::: :::::.:::::::::::.::::::::::::::::: :::::::::::
TGGTGAACCGCAGCCAGAAGGACATCGAGGGCAAGAAGGACATTCGTGCAGCTCTGGCGGCTGAGAGGAAATTCTTCCTCTCCCACCCCGCCTACCGGCA
V--V--N--R--S--Q--K--D--I--E--G--K--K--D--I--R--A--A--L--A--A--E--R--K--F--F--L--S--H--P--A--Y--R--H

------------------------------------------------><--------------------------------------------------
--M--A--D--R--M--G--T--P--H--L--Q--K--T--L--N--Q--Q--L--T--N--H--I--R--E--S--L--P--A--L--R--S--K--L-
CATGGCCGACCGCATGGGCACGCCACATCTGCAGAAGACGCTGAATCAGCAACTGACCAACCACATCCGGGAGTCGCTGCCGGCCCTACGTAGCAAACTA
::::::.:::::::::::::: :::::.::::::::::: ::::::::::::::::::::.::::::::::::::::::::.:::.:.::.:::::.::.
CATGGCTGACCGCATGGGCACCCCACACCTGCAGAAGACTCTGAATCAGCAACTGACCAATCACATCCGGGAGTCGCTGCCAGCCTTGCGCAGCAAGCTG
--M--A--D--R--M--G--T--P--H--L--Q--K--T--L--N--Q--Q--L--T--N--H--I--R--E--S--L--P--A--L--R--S--K--L-

-------------------------------------------------------------------------------------------><-------
-Q--S--Q--L--L--S--L--E--K--E--V--E--E--Y--K--N--F--R--P--D--D--P--T--R--K--T--K--A--L--L--Q--M--V--
CAGAGCCAGCTGCTGTCCCTGGAGAAGGAGGTGGAGGAGTACAAGAACTTTCGGCCCGACGACCCCACCCGCAAAACCAAAGCCCTGCTGCAGATGGTCC
::::::::::::::::::.::::::::::::::::::::::.::::::::.::.::.:::::.:::::.:::::.::::::::.::::::   :::::::
CAGAGCCAGCTGCTGTCCTTGGAGAAGGAGGTGGAGGAGTATAAGAACTTCCGACCTGACGATCCCACTCGCAAGACCAAAGCTCTGCTG---ATGGTCC
-Q--S--Q--L--L--S--L--E--K--E--V--E--E--Y--K--N--F--R--P--D--D--P--T--R--K--T--K--A--L--L-----M--V--

----------------------------------------------------------------------------------------------------
Q--Q--F--G--V--D--F--E--K--R--I--E--G--S--G--D--Q--V--D--T--L--E--L--S--G--G--A--R--I--N--R--I--F--H
AGCAGTTTGGGGTGGATTTTGAGAAGAGGATCGAGGGCTCAGGAGATCAGGTGGACACTCTGGAGCTCTCCGGGGGCGCCCGAATCAATCGCATCTTCCA
::::.:::::::::::.::::::::::::::::::::.:: :::::.::.:::::::: ::.::::::::::::::::::::::::::::::::::::::
AGCAATTTGGGGTGGACTTTGAGAAGAGGATCGAGGGTTCTGGAGACCAAGTGGACACGCTAGAGCTCTCCGGGGGCGCCCGAATCAATCGCATCTTCCA
Q--Q--F--G--V--D--F--E--K--R--I--E--G--S--G--D--Q--V--D--T--L--E--L--S--G--G--A--R--I--N--R--I--F--H

------------------------------><-------------------------------------------------------------><---><
--E--R--F--P--F--E--L--V--K--M--E--F--D--E--K--D--L--R--R--E--I--S--Y--A--I--K--N--I--H--G--H--E--T-
CGAGCGGTTCCCATTTGAGCTGGTGAAGATGGAGTTTGACGAGAAGGACTTACGACGGGAGATCAGCTATGCCATTAAGAACATCCATGGACATGAGACC
.:::::::: :: :::::::::::::::                              :::::::::::::::::::::::::::::::::         
TGAGCGGTT-CCCTTTGAGCTGGTGAAG------------------------------GAGATCAGCTATGCCATTAAGAACATCCATGGA---------
--E--R--F--P--F--E--L--V--K--------------------------------E--I--S--Y--A--I--K--N--I--H--G----------

----------------------------------------------------------------------------------------------------
-G--L--F--T--P--D--L--A--F--E--A--I--V--K--K--Q--V--V--K--L--K--E--P--C--L--K--C--V--D--L--V--I--Q--
GGGCTTTTCACCCCGGACTTGGCATTCGAGGCCATTGTGAAAAAGCAGGTCGTCAAGCTGAAAGAGCCCTGTCTGAAATGTGTCGACCTGGTTATCCAGG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-------------------------------------><-------------------------------------------------------------
E--L--I--N--T--V--R--Q--C--T--S--K--L--S--S--Y--P--R--L--R--E--E--T--E--R--I--V--T--T--Y--I--R--E--R
AGCTAATCAATACAGTTAGGCAGTGTACCAGTAAGCTCAGTTCCTACCCCCGGTTGCGAGAGGAGACAGAGCGAATCGTCACCACTTACATCCGGGAACG
                                   :::::.::::::::::::.:::::::::::::.::.:::::::::::::::::::::::::::::
-----------------------------------CTCAGCTCCTACCCCCGGCTGCGAGAGGAGACGGAACGAATCGTCACCACTTACATCCGGGAACG
------------------------------------L--S--S--Y--P--R--L--R--E--E--T--E--R--I--V--T--T--Y--I--R--E--R

------------------------><---------------------------------------------------------------------><---
--E--G--R--T--K--D--Q--I--L--L--L--I--D--I--E--Q--S--Y--I--N--T--N--H--E--D--F--I--G--F--A--N--A--Q-
GGAGGGGAGAACGAAGGACCAGATTCTTCTGCTGATCGACATTGAGCAGTCCTACATCAACACGAACCATGAGGACTTCATCGGGTTTGCCAATGCCCAG
:::::::::::: ::::::::::::::::: :::::::::::.::::::::::::::::::::::::::.:::::::::::.::.::::::   ::::::
GGAGGGGAGAACCAAGGACCAGATTCTTCTTCTGATCGACATCGAGCAGTCCTACATCAACACGAACCACGAGGACTTCATTGGATTTGCC---GCCCAG
--E--G--R--T--K--D--Q--I--L--L--L--I--D--I--E--Q--S--Y--I--N--T--N--H--E--D--F--I--G--F--A-----A--Q-

-----------------------------------------------><---------------------------------------------------
-Q--R--S--T--Q--L--N--K--K--R--A--I--P--N--Q--V--I--R--R--G--W--L--T--I--N--N--I--S--L--M--K--G--G--
CAGAGGAGCACGCAGCTGAACAAGAAGAGAGCCATCCCCAATCAGGTGATCCGCAGGGGCTGGCTGACCATCAACAACATCAGCCTGATGAAAGGCGGCT
:::::.:::::.:::::::::::::::::::::::::::::.:::::::::::: :::::::::::::::::::::::::::::::::::::.:::::::
CAGAGAAGCACACAGCTGAACAAGAAGAGAGCCATCCCCAACCAGGTGATCCGCCGGGGCTGGCTGACCATCAACAACATCAGCCTGATGAAGGGCGGCT
-Q--R--S--T--Q--L--N--K--K--R--A--I--P--N--Q--V--I--R--R--G--W--L--T--I--N--N--I--S--L--M--K--G--G--

-------------------------------------------------------------><-------------------------------------
S--K--E--Y--W--F--V--L--T--A--E--S--L--S--W--Y--K--D--E--E--E--K--E--K--K--Y--M--L--P--L--D--N--L--K
CCAAGGAGTACTGGTTTGTGCTGACTGCCGAGTCACTGTCCTGGTACAAGGATGAGGAGGAGAAAGAGAAGAAGTACATGCTGCCTCTGGACAACCTCAA
:::::::.::::::::::::::::: ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCAAGGAATACTGGTTTGTGCTGACAGCCGAGTCACTGTCCTGGTACAAGGATGAGGAGGAGAAAGAGAAGAAGTACATGCTGCCTCTGGACAACCTCAA
S--K--E--Y--W--F--V--L--T--A--E--S--L--S--W--Y--K--D--E--E--E--K--E--K--K--Y--M--L--P--L--D--N--L--K

--------------------------------------------------------------------------><------------------------
--I--R--D--V--E--K--G--F--M--S-----N--K--H--V--F--A--I--F--N--T--E--Q--R--N--V--Y--K--D--L--R--Q--I-
GATCCGTGATGTGGAGAAGGGCTTCATGTCC---AACAAGCACGTCTTCGCCATCTTCAACACGGAGCAGAGAAACGTCTACAAGGACCTGCGGCAGATC
.::::::::::::::.:::::::::::::::   ::::::::.::::::::::::::::::::.::::::   :::::::::::::::::::::::::::
AATCCGTGATGTGGAAAAGGGCTTCATGTCCA--AACAAGCATGTCTTCGCCATCTTCAACACAGAGCAG---AACGTCTACAAGGACCTGCGGCAGATC
--I--R--D--V--E--K--G--F--M--S--\--N--K--H--V--F--A--I--F--N--T--E--Q-----N--V--Y--K--D--L--R--Q--I-

--------------------------------------------------------------------------------------><------------
-E--L--A--C--D--S--Q--E--D--V--D--S--W--K--A--S--F--L--R--A--G--V--Y--P--E--K--D--Q--A--E--N--E--D--
GAGCTGGCCTGTGACTCCCAGGAAGACGTGGACAGCTGGAAGGCCTCGTTCCTCCGAGCTGGCGTCTACCCCGAGAAGGACCAGGCAGAAAACGAGGATG
:::::::::::::::::::::::.:::::::::::::::::::::::.:::::::::::.:: ::::::::.:::::::::::::::::.::.:::::::
GAGCTGGCCTGTGACTCCCAGGAGGACGTGGACAGCTGGAAGGCCTCATTCCTCCGAGCCGGGGTCTACCCTGAGAAGGACCAGGCAGAGAATGAGGATG
-E--L--A--C--D--S--Q--E--D--V--D--S--W--K--A--S--F--L--R--A--G--V--Y--P--E--K--D--Q--A--E--N--E--D--

----------------------------------------------------------------------------------------------------
G--A--Q--E--N--T--F--S--M--D--P--Q--L--E--R--Q--V--E--T--I--R--N--L--V--D--S--Y--V--A--I--I--N--K--S
GGGCCCAGGAGAACACCTTCTCCATGGACCCCCAACTGGAGCGGCAGGTGGAGACCATTCGCAACCTGGTGGACTCATACGTGGCCATCATCAACAAGTC
:.::::::::::::::::::::::::::::: ::.::.::::: ::::::::::::::::: ::::::::::::::::::::::::::::::::::::::
GAGCCCAGGAGAACACCTTCTCCATGGACCCGCAGCTAGAGCGCCAGGTGGAGACCATTCGAAACCTGGTGGACTCATACGTGGCCATCATCAACAAGTC
G--A--Q--E--N--T--F--S--M--D--P--Q--L--E--R--Q--V--E--T--I--R--N--L--V--D--S--Y--V--A--I--I--N--K--S

---------------------------------------------------><-----------------------------------------------
--I--R--D--L--M--P--K--T--I--M--H--L--M--I--N--N--T--K--A--F--I--H--H--E--L--L--A--Y--L--Y--S--S--A-
CATCCGCGACCTCATGCCAAAGACCATCATGCACCTCATGATCAACAATACGAAGGCCTTCATCCACCACGAGCTGCTGGCCTACCTATACTCCTCGGCA
::::::.::::::::::::::::::::::::::::::::::::::.   ::::::::::::::::::::.:::::::::::::::::.::::: ::.:: 
CATCCGTGACCTCATGCCAAAGACCATCATGCACCTCATGATCAAT---ACGAAGGCCTTCATCCACCATGAGCTGCTGGCCTACCTGTACTCGTCAGCC
--I--R--D--L--M--P--K--T--I--M--H--L--M--I--N-----T--K--A--F--I--H--H--E--L--L--A--Y--L--Y--S--S--A-

----------------------------------------------------------------------------------------------------
-D--Q--S--S--L--M--E--E--S--A--D--Q--A--Q--R--R--D--D--M--L--R--M--Y--H--A--L--K--E--A--L--N--I--I--
GACCAGAGCAGCCTCATGGAGGAGTCGGCTGACCAGGCACAGCGGCGGGACGACATGCTGCGCATGTACCATGCCCTCAAGGAGGCGCTCAACATCATCG
::::::::::::::::::::::::::.::::::::::: ::::::::::::::::::::::::::::::::::: :::::::::::.:::::::::::.:
GACCAGAGCAGCCTCATGGAGGAGTCAGCTGACCAGGCCCAGCGGCGGGACGACATGCTGCGCATGTACCATGCGCTCAAGGAGGCACTCAACATCATTG
-D--Q--S--S--L--M--E--E--S--A--D--Q--A--Q--R--R--D--D--M--L--R--M--Y--H--A--L--K--E--A--L--N--I--I--

------------------------------------------------------------------------------------><--------------
G--D--I--S--T--S--T--V--S--T--P--V--P--P--P--V--D--D--T--W--L--Q--S--A--S--S--H--S--P--T--P--Q--R--R
GTGACATCAGCACCAGCACTGTGTCCACGCCTGTACCCCCGCCTGTCGATGACACCTGGCTCCAGAGCGCCAGCAGCCACAGCCCCACTCCACAGCGCCG
: :::::::::::::::::.::::::::::: ::.::::::::.::.:::::::::::::::::::::.:::::::::::   ::::::::.::.:::::
GGGACATCAGCACCAGCACCGTGTCCACGCCGGTGCCCCCGCCCGTTGATGACACCTGGCTCCAGAGCACCAGCAGCCAC---CCCACTCCGCAACGCCG
G--D--I--S--T--S--T--V--S--T--P--V--P--P--P--V--D--D--T--W--L--Q--S--T--S--S--H-----P--T--P--Q--R--R

----------------------------------------------------------------------------------------------------
--P--V--S--S--I--H--P--P--G--R--P--P--A--V--R--G--P--T--P--G--P--P--L--I--P--V--P--V--G--A--A--A--S-
ACCGGTGTCCAGCATACACCCCCCTGGCCGGCCCCCAGCAGTGAGGGGCCCCACTCCAGGGCCCCCCCTGATTCCTGTTCCCGTGGGGGCAGCAGCCTCC
.:: :::::::::.:.:::::::: :::::::::::::::::::::::::::::.::.:::::::::::::::::::: :: :::::.::::::::::::
GCCTGTGTCCAGCGTGCACCCCCCAGGCCGGCCCCCAGCAGTGAGGGGCCCCACCCCGGGGCCCCCCCTGATTCCTGTGCCGGTGGGAGCAGCAGCCTCC
--P--V--S--S--V--H--P--P--G--R--P--P--A--V--R--G--P--T--P--G--P--P--L--I--P--V--P--V--G--A--A--A--S-

----------------------------------------------------------------------------------------------------
-F--S--A--P--P--I--P--S--R--P--G--P--Q-----S--V--F--A--N--S--D--L--F--P--A--P--P--Q--I--P--S--R--P--
TTCTCGGCGCCCCCAATCCCATCCCGGCCTGGACCCCAG---AGCGTGTTTGCCAACAGTGACCTCTTCCCAGCCCCGCCTCAGATCCCATCTCGGCCAG
::::: :::::::: :::::::::::::::::::::::    .:::::::::::::::.:::::.::::.:.:::::::::::::::::::::::.::::
TTCTCCGCGCCCCCCATCCCATCCCGGCCTGGACCCCATCCTGGCGTGTTTGCCAACAATGACCCCTTCTCGGCCCCGCCTCAGATCCCATCTCGACCAG
-F--S--A--P--P--I--P--S--R--P--G--P--H--P--G--V--F--A--N--N--D--P--F--S--A--P--P--Q--I--P--S--R--P--

---------------------------------------><-----------------------------------------------------------
V--R--I--P--P--G--I--P--P--G--V--P--S--R--R--P--P--A--A--P--S--R--P--T--I--I--R--P--A--E--P--S--L--L
TTCGGATCCCCCCAGGGATTCCCCCAGGAGTGCCCAGCAGAAGACCCCCTGCTGCGCCCAGCCGGCCCACCATTATCCGCCCAGCCGAGCCATCCCTGCT
.::::::.:: :: :: :: ::::: ::::: :::   ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CTCGGATTCCACCCGGCATACCCCCCGGAGTCCCC---AGAAGACCCCCTGCTGCGCCCAGCCGGCCCACCATTATCCGCCCAGCCGAGCCATCCCTGCT
A--R--I--P--P--G--I--P--P--G--V--P-----R--R--P--P--A--A--P--S--R--P--T--I--I--R--P--A--E--P--S--L--L

-------
--D--*-
CGACTAG
:::::::
CGACTAG
--D--*-

Pig Consensus Sequence

>BGISUST0000887356
------------------------------CCGCTGGTCAACAAGCTGCAGGATGCCTTCAGCTCCATCGGCCAGAGCTGCCACCTGGACCTGCCGCAGA
TTGCCGTGGTGGGCGGCCAGAGCGCCGGCAAGAGCTCAGTGCTCGAGAACTTCGTGGGC---GACTTCCTTCCCCGAGGTTCAGGAATCGTCACTCGGCG
GCCTCTCATTCTGCAGCTCATCTTCTCAAAAACA---------------------------------------ACAGACTTNNNNNAAGTCCGACAGGAG
ATCGAAGCGGAGACCGACAGGGTCACGGGGACCAATAAAGGCATCTCCCCAGTGCCCATCAACTTGCGGGTCTACTCACCACAC---TTGAACCTGACCC
TCATCGACCTGCCGGGCATCACCAAGGTGCCCGTGGGGGACCAGCCCCCAGACATCGAGTACCAGATCAAGGACATGATCCTGCAGTTCATCAGCCGGGA
GAGCAGCCTCATCCTCGCCGTCACCCCCGCCAACATGGACCTGGCCAACTCGGACGCCCTCAAGCTGGCCAAGGAGGTCGACCCTCAA---CTGCGGACC
ATTGGCGTCATCACCAAGCTTGACCTGATGGACGAAGGCACTGATGCCAGGGATGTCCTGGAGAACAAGCTGCTCCCCTTGAGAAGA---TACATTGGTG
TGGTGAACCGCAGCCAGAAGGACATCGAGGGCAAGAAGGACATTCGTGCAGCTCTGGCGGCTGAGAGGAAATTCTTCCTCTCCCACCCCGCCTACCGGCA
CATGGCTGACCGCATGGGCACCCCACACCTGCAGAAGACTCTGAATCAGCAACTGACCAATCACATCCGGGAGTCGCTGCCAGCCTTGCGCAGCAAGCTG
CAGAGCCAGCTGCTGTCCTTGGAGAAGGAGGTGGAGGAGTATAAGAACTTCCGACCTGACGATCCCACTCGCAAGACCAAAGCTCTGCTG---ATGGTCC
AGCAATTTGGGGTGGACTTTGAGAAGAGGATCGAGGGTTCTGGAGACCAAGTGGACACGCTAGAGCTCTCCGGGGGCGCCCGAATCAATCGCATCTTCCA
TGAGCGgcCCTTTGAGCTGGTGAAG------------------------------GAGATCAGCTATGCCATTAAGAACATCCATGGA------------
----------------------------------------------------------------------------------------------------
--------------------------------CTCAGCTCCTACCCCCGGCTGCGAGAGGAGACGGAACGAATCGTCACCACTTACATCCGGGAACGGGA
GGGGAGAACCAAGGACCAGATTCTTCTTCTGATCGACATCGAGCAGTCCTACATCAACACGAACCACGAGGACTTCATTGGATTTGCC---GCCCAGCAG
AGAAGCACACAGCTGAACAAGAAGAGAGCCATCCCCAACCAGGTGATCCGCCGGGGCTGGCTGACCATCAACAACATCAGCCTGATGAAGGGCGGCTCCA
AGGAATACTGGTTTGTGCTGACAGCCGAGTCACTGTCCTGGTACAAGGATGAGGAGGAGAAAGAGAAGAAGTACATGCTGCCTCTGGACAACCTCAAAAT
CCGTGATGTGGAAAAGGGCTTCATGTCcaACAAGCATGTCTTCGCCATCTTCAACACAGAGCAG---AACGTCTACAAGGACCTGCGGCAGATCGAGCTG
GCCTGTGACTCCCAGGAGGACGTGGACAGCTGGAAGGCCTCATTCCTCCGAGCCGGGGTCTACCCTGAGAAGGACCAGGCAGAGAATGAGGATGGAGCCC
AGGAGAACACCTTCTCCATGGACCCGCAGCTAGAGCGCCAGGTGGAGACCATTCGAAACCTGGTGGACTCATACGTGGCCATCATCAACAAGTCCATCCG
TGACCTCATGCCAAAGACCATCATGCACCTCATGATCAAT---ACGAAGGCCTTCATCCACCATGAGCTGCTGGCCTACCTGTACTCGTCAGCCGACCAG
AGCAGCCTCATGGAGGAGTCAGCTGACCAGGCCCAGCGGCGGGACGACATGCTGCGCATGTACCATGCGCTCAAGGAGGCACTCAACATCATTGGGGACA
TCAGCACCAGCACCGTGTCCACGCCGGTGCCCCCGCCCGTTGATGACACCTGGCTCCAGAGCACCAGCAGCCAC---CCCACTCCGCAACGCCGGCCTGT
GTCCAGCGTGCACCCCCCAGGCCGGCCCCCAGCAGTGAGGGGCCCCACCCCGGGGCCCCCCCTGATTCCTGTGCCGGTGGGAGCAGCAGCCTCCTTCTCC
GCGCCCCCCATCCCATCCCGGCCTGGACCCCATCCTGGCGTGTTTGCCAACAATGACCCCTTCTCGGCCCCGCCTCAGATCCCATCTCGACCAGCTCGGA
TTCCACCCGGCATACCCCCCGGAGTC---AGAAGACCCCCTGCTGCGCCCAGCCGGCCCACCATTATCCGCCCAGCCGAGCCATCCCTGCTCGACTAG


>BGISUSP0000887356
----------PLVNKLQDAFSSIGQSCHLDLPQIAVVGGQSAGKSSVLENFVG-DFLPRGSGIVTRRPLILQLIFSKT-------------TD---VRQE
IEAETDRVTGTNKGISPVPINLRVYSPH-LNLTLIDLPGITKVPVGDQPPDIEYQIKDMILQFISRESSLILAVTPANMDLANSDALKLAKEVDPQ-LRT
IGVITKLDLMDEGTDARDVLENKLLPLRR-YIGVVNRSQKDIEGKKDIRAALAAERKFFLSHPAYRHMADRMGTPHLQKTLNQQLTNHIRESLPALRSKL
QSQLLSLEKEVEEYKNFRPDDPTRKTKALL-MVQQFGVDFEKRIEGSGDQVDTLELSGGARINRIFHERPFELVK----------EISYAIKNIHG----
--------------------------------------------LSSYPRLREETERIVTTYIREREGRTKDQILLLIDIEQSYINTNHEDFIGFA-AQQ
RSTQLNKKRAIPNQVIRRGWLTINNISLMKGGSKEYWFVLTAESLSWYKDEEEKEKKYMLPLDNLKIRDVEKGFMSNKHVFAIFNTEQ-NVYKDLRQIEL
ACDSQEDVDSWKASFLRAGVYPEKDQAENEDGAQENTFSMDPQLERQVETIRNLVDSYVAIINKSIRDLMPKTIMHLMIN-TKAFIHHELLAYLYSSADQ
SSLMEESADQAQRRDDMLRMYHALKEALNIIGDISTSTVSTPVPPPVDDTWLQSTSSH-PTPQRRPVSSVHPPGRPPAVRGPTPGPPLIPVPVGAAASFS
APPIPSRPGPHPGVFANNDPFSAPPQIPSRPARIPPGIPPGV-RRPPAAPSRPTIIRPAEPSLLD*