Sequences
EST Library Info
pan2Pancreas
thg1Thyroid gland
ute2Uterus
Clusters
Oligos
SNPs

Gene ID ENSG00000080345 (click for geneview)
Transcript ID ENST00000359799(link to ensembl)
Symbol RIF1
Localtion Chromosome:2:152092446:152157093:1 band: 2q23.3
Description RAP1 interacting factor 1 [Source:RefSeq_peptide;Acc:NP_060621]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--T--A--R--G--Q--S--P--L--A--P--L--L--E--T--L--E--D--P--S--A--S--H--G--G--Q--T--D--A--Y--L--T--L--
ATGACGGCCAGGGGTCAGAGCCCCCTCGCGCCGCTGTTGGAGACTTTGGAAGACCCTTCTGCCTCCCATGGAGGGCAGACTGACGCTTACCTGACTCTGA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

---><-----------------------------------------------------------------------------><----------------
T--S--R--M--T--G--E--E--G--K--E--V--I--T--E--I--E--K--K--L--P--R--L--Y--K--V--L--K--T--H--I--S--S--Q
CCAGTCGTATGACTGGAGAAGAAGGAAAAGAAGTAATTACAGAAATTGAGAAAAAACTTCCTCGGCTGTACAAAGTTTTAAAGACTCACATTTCCAGTCA
                                   ::::.::::::::::::::::::::::::::: : :::::::::::::   :::::  :::::::
-----------------------------------ATTATAGAAATTGAGAAAAAACTTCCTCGGCTCTTCAAAGTTTTAAAG---CACATAACCAGTCA
------------------------------------I--I--E--I--E--K--K--L--P--R--L--F--K--V--L--K-----H--I--T--S--Q

-------------------------------------------------------------------------------><-------------------
--N--S--E--L--S--S--A--A--L--Q--A--L--G--F--C--L--Y--N--P--K--I--T--S--E--L--S--E--A--N--A--L--E--L-
AAACTCGGAGCTGAGTAGTGCTGCTCTACAAGCCCTGGGGTTTTGCTTATATAATCCCAAAATTACCTCAGAATTATCAGAGGCAAATGCTCTAGAATTG
::::::.::::: :::::::::::::::::.:::.::::::::::::::::::::::.:::::::: :::: :::::::               :::.::
AAACTCAGAGCTCAGTAGTGCTGCTCTACAGGCCTTGGGGTTTTGCTTATATAATCCTAAAATTACATCAGCATTATCA---------------GAACTG
--N--S--E--L--S--S--A--A--L--Q--A--L--G--F--C--L--Y--N--P--K--I--T--S--A--L--S-----------------E--L-

----------------------------------------------------------------------------------------------------
-L--S--K--L--N--D--T--I--K--N--S--D--K--N--V--R--T--R--A--L--W--V--I--S--K--Q--T--F--P--S--E--V--V--
CTTTCAAAATTGAATGATACCATTAAGAATTCAGACAAAAATGTACGTACTAGAGCACTTTGGGTGATATCTAAGCAGACATTTCCCTCTGAAGTGGTTG
:::::::::.::::::::::.:::::::.::::::.:::::::: ::::::::.:::::::::::::::::.::::::::.::::::.:::::::  :::
CTTTCAAAACTGAATGATACTATTAAGAGTTCAGATAAAAATGTTCGTACTAGGGCACTTTGGGTGATATCCAAGCAGACGTTTCCCCCTGAAGTTCTTG
-L--S--K--L--N--D--T--I--K--S--S--D--K--N--V--R--T--R--A--L--W--V--I--S--K--Q--T--F--P--P--E--V--L--

-------><-------------------------------------------------------------------------------------------
G--K--M--V--S--S--I--I--D--S--L--E--I--L--F--N--K--G--E--T--H--S--A--V--V--D--F--E--A--L--N--V--I--V
GCAAAATGGTATCCAGTATAATTGATTCATTAGAAATACTGTTTAACAAAGGAGAGACGCATTCTGCTGTTGTTGATTTTGAAGCATTAAATGTTATCGT
:::::                                                                                               
GCAAA-----------------------------------------------------------------------------------------------
G--K------------------------------------------------------------------------------------------------

--><------------------------------------------------------------------------------------------------
--R--L--I--E--Q--A--P--I--Q--M--G--E--E--A--V--R--W--A--K--L--V--I--P--L--V--V--H--S--A--Q--K--V--H-
AAGGCTAATTGAACAAGCCCCAATTCAAATGGGAGAAGAGGCAGTGAGGTGGGCAAAACTGGTCATACCTTTAGTGGTTCATTCAGCACAAAAGGTACAT
    :::::::::::::::::::::::::::::.:::::: ::.: : :::::::::: :::::::::::                              
----CTAATTGAACAAGCCCCAATTCAAATGGGGGAAGAGTCAATTACGTGGGCAAAAGTGGTCATACCT------------------------------
-----L--I--E--Q--A--P--I--Q--M--G--E--E--S--I--T--W--A--K--V--V--I--P-------------------------------

--------------------------------------------------------------------------------------------><------
-L--R--G--A--T--A--L--E--M--G--M--P--L--L--L--Q--K--Q--Q--E--I--A--S--I--T--E--Q--L--M--T--T--K--L--
TTGCGGGGAGCAACTGCTCTGGAGATGGGAATGCCATTATTGCTTCAGAAACAGCAAGAAATAGCATCTATTACGGAGCAGCTTATGACTACTAAATTAA
                                                                                             :::::: 
---------------------------------------------------------------------------------------------AAATTAC
----------------------------------------------------------------------------------------------K--L--

-------------------------------------------------------------------------------------><-------------
I--S--E--L--Q--K--L--F--M--S--K--N--E--T--Y--V--L--K--L--W--P--L--F--V--K--L--L--G--R--T--L--H--R--S
TCTCAGAACTTCAGAAGCTATTTATGAGTAAAAATGAGACTTACGTGTTAAAATTATGGCCTTTGTTTGTCAAACTACTTGGAAGGACCTTGCATCGAAG
:.::::::::.::::::::::::::::::::::::::::: ::.:::::::::::::::::::::::::::::.:: :::::.:.:              
TTTCAGAACTCCAGAAGCTATTTATGAGTAAAAATGAGACGTATGTGTTAAAATTATGGCCTTTGTTTGTCAAGCTTCTTGGGAAG--------------
L--S--E--L--Q--K--L--F--M--S--K--N--E--T--Y--V--L--K--L--W--P--L--F--V--K--L--L--G--K---------------

----------------------------------------------------------------------------------------------------
--G--S--F--I--N--S--L--L--Q--L--E--E--L--G--F--R--S--G--A--P--M--I--K--K--I--A--F--I--A--W--K--S--L-
TGGGAGTTTCATCAATTCTCTCTTGCAACTAGAAGAACTTGGATTTCGTAGTGGAGCACCCATGATTAAAAAGATAGCTTTTATTGCTTGGAAGAGTTTA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

------------------------><--------------------------------------------------------------------------
-I--D--N--F--A--L--N--P--D--I--L--C--S--A--K--R--L--K--L--L--M--Q--P--L--S--S--I--H--V--R--T--E--T--
ATAGATAATTTTGCTTTAAATCCAGATATACTATGTAGTGCAAAAAGACTCAAGTTGTTAATGCAGCCTTTGAGTTCCATCCATGTGAGAACAGAAACTC
                           ::::::::::::::::::::::: ::::::::::::::.:::::::::::.::::::::::::::::::.:::
---------------------------ATACTATGTAGTGCAAAAAGACTGAAGTTGTTAATGCAACCTTTGAGTTCTATCCATGTGAGAACAGAAGCTC
----------------------------I--L--C--S--A--K--R--L--K--L--L--M--Q--P--L--S--S--I--H--V--R--T--E--A--

----------------------------------------------------------------------------><----------------------
L--A--L--T--K--L--E--V--W--W--Y--L--L--M--R--L--G--P--H--L--P--A--N--F--E--Q--V--C--V--P--L--I--Q--S
TAGCATTAACAAAACTAGAAGTCTGGTGGTATTTACTGATGAGACTTGGACCTCATCTTCCTGCTAATTTTGAACAGGTTTGTGTGCCTCTGATTCAAAG
:::::.:.::::::::::::::::::::::::.::.::                                       :::::::::::::::::::::::
TAGCACTGACAAAACTAGAAGTCTGGTGGTATCTATTG---------------------------------------GTTTGTGTGCCTCTGATTCAAAG
L--A--L--T--K--L--E--V--W--W--Y--L--L-----------------------------------------V--C--V--P--L--I--Q--S

----------------------------------------------------------------------------------------------><----
--T--I--S--I--D--S--N--A--S--P--Q--G--N--S--C--H--V--A--T--S--P--G--L--N--P--M--T--P--V--H--K--G--A-
TACAATAAGCATTGATTCTAATGCCTCACCTCAGGGCAATTCGTGTCATGTAGCTACATCTCCAGGTTTAAATCCTATGACTCCTGTACACAAAGGTGCT
.:::::::::::.:::::::::::.::::::::.::::.:::.: ::.::::::::: ::::::::::::::::::::::::::::::::::::      
CACAATAAGCATCGATTCTAATGCTTCACCTCAAGGCAGTTCATCTCGTGTAGCTACTTCTCCAGGTTTAAATCCTATGACTCCTGTACACAAA------
--T--I--S--I--D--S--N--A--S--P--Q--G--S--S--S--R--V--A--T--S--P--G--L--N--P--M--T--P--V--H--K-------

----------------------------------------------------------------------------------------------------
-S--S--P--Y--G--A--P--G--T--P--R--M--N--L--S--S--N--L--G--G--M--A--T--I--P--S--I--Q--L--L--G--L--E--
TCCTCCCCGTACGGAGCCCCGGGAACTCCCCGAATGAACCTGAGTTCGAATTTAGGTGGAATGGCCACAATCCCATCCATTCAACTTTTGGGACTTGAAA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-----------------------------------------------------------------------><---------------------------
M--L--L--H--F--L--L--G--P--E--A--L--S--F--A--K--Q--N--K--L--V--L--S--L--E--P--L--E--H--P--L--I--S--S
TGTTGCTTCATTTCTTGTTGGGTCCAGAAGCCTTGAGTTTTGCTAAGCAAAATAAACTTGTGCTGAGCTTAGAGCCATTGGAACATCCGTTAATCAGCAG
                                                                          :::.: ::::::::.:::::::::::
--------------------------------------------------------------------------CCACTTGAACATCCATTAATCAGCAG
---------------------------------------------------------------------------P--L--E--H--P--L--I--S--S

----------------------------------------------------------------------------------><----------------
--P--S--F--F--S--K--H--A--N--T--L--I--T--A--V--H--D--S--F--V--A--V--G--K--D--A--P--D--V--V--V--S--A-
CCCTTCCTTTTTTTCCAAACATGCAAATACACTTATCACTGCTGTTCATGATAGCTTTGTTGCAGTTGGAAAAGATGCCCCCGATGTGGTTGTCAGTGCT
:.::::.::::::::::::::::: ::::::::::::::.::::::::::::::.::::::::::::::.::::::                        
CTCTTCTTTTTTTTCCAAACATGCTAATACACTTATCACCGCTGTTCATGATAGTTTTGTTGCAGTTGGGAAAGAT------------------------
--S--S--F--F--S--K--H--A--N--T--L--I--T--A--V--H--D--S--F--V--A--V--G--K--D-------------------------

---------------------------------------------><-----------------------------------------------------
-I--W--K--E--L--I--S--L--V--K--S--V--T--E--S--G--N--K--K--E--K--P--G--S--E--V--L--T--L--L--L--K--S--
ATCTGGAAGGAGCTAATTAGCTTGGTGAAGTCAGTTACTGAATCAGGTAACAAAAAAGAGAAACCAGGTTCTGAAGTTTTGACTCTCTTATTAAAGTCTT
                                                ::::.::::::::..:: :::::::::::::::::.:::::::::::.: :.
------------------------------------------------AACAGAAAAGAGAGGCCCGGTTCTGAAGTTTTGACCCTCTTATTAAAATGTC
-------------------------------------------------N--R--K--E--R--P--G--S--E--V--L--T--L--L--L--K--C--

----------------------------------------------><----------------------------------------------------
L--E--S--I--V--K--S--E--V--F--P--V--S--K--T--L--V--L--M--E--I--T--I--K--G--L--P--Q--K--V--L--G--S--P
TGGAAAGCATAGTAAAGTCTGAAGTATTTCCTGTATCAAAAACGCTGGTCCTCATGGAAATTACAATTAAAGGACTTCCTCAGAAAGTATTAGGTTCACC
:.:::::.:::::.::::: ::::::::::::::::::::::.:::::::::::::::::::::::::::::::::::::::::::::::::::::: ::
TAGAAAGTATAGTGAAGTCAGAAGTATTTCCTGTATCAAAAATGCTGGTCCTCATGGAAATTACAATTAAAGGACTTCCTCAGAAAGTATTAGGTTCTCC
L--E--S--I--V--K--S--E--V--F--P--V--S--K--M--L--V--L--M--E--I--T--I--K--G--L--P--Q--K--V--L--G--S--P

---------------------------------><-----------------------------------------------------------------
--A--Y--Q--V--A--N--M--D--I--L--N--G--T--P--A--L--F--L--I--Q--L--I--F--N--N--F--L--E--C--G--V--S--D-
AGCATATCAGGTTGCTAATATGGATATTCTTAATGGAACTCCAGCTTTGTTCTTAATTCAATTAATTTTCAACAATTTCTTGGAATGTGGTGTATCAGAT
:::::::::::::::::::::::::::::::::::::::::: :::::::::::::::::.:::::::::::.:::  ..::::::::::::::  ::::
AGCATATCAGGTTGCTAATATGGATATTCTTAATGGAACTCCTGCTTTGTTCTTAATTCAGTTAATTTTCAATAATAATCTGGAATGTGGTGTAGAAGAT
--A--Y--Q--V--A--N--M--D--I--L--N--G--T--P--A--L--F--L--I--Q--L--I--F--N--N--N--L--E--C--G--V--E--D-

----><----------------------------------------------------------------------------------------------
-E--R--F--F--L--S--L--E--S--L--V--G--C--V--L--S--G--P--T--S--P--L--A--F--S--D--S--V--L--N--V--I--N--
GAAAGGTTCTTTCTCAGTTTGGAATCACTTGTAGGCTGTGTTCTTTCTGGTCCAACTTCACCACTAGCTTTCAGTGACTCAGTTTTAAATGTTATTAATC
:::   ::.::::::::..::::: : ::::::::. :::::::::::::::::::::::::::::::::::::.::::: ::.::::::::::::::.:
GAA---TTTTTTCTCAGCCTGGAAACTCTTGTAGGTAGTGTTCTTTCTGGTCCAACTTCACCACTAGCTTTCAGCGACTCCGTCTTAAATGTTATTAACC
-E-----F--F--L--S--L--E--T--L--V--G--S--V--L--S--G--P--T--S--P--L--A--F--S--D--S--V--L--N--V--I--N--

-------------------------------------------------------------------------------------><-------------
Q--N--A--K--Q--L--E--N--K--E--H--L--W--K--M--W--S--V--I--V--T--P--L--T--E--L--I--N--Q--T--N--E--V--N
AAAATGCAAAGCAGTTGGAAAATAAGGAGCATCTCTGGAAAATGTGGAGTGTTATAGTCACCCCATTAACTGAATTGATTAATCAGACCAATGAAGTAAA
::::::::::::::::::::::.:::::::::::.::::.::::::::::.:::::::::::                        :::::::::::.::
AAAATGCAAAGCAGTTGGAAAACAAGGAGCATCTTTGGAGAATGTGGAGTATTATAGTCACC------------------------ACCAATGAAGTGAA
Q--N--A--K--Q--L--E--N--K--E--H--L--W--R--M--W--S--I--I--V--T--------------------------T--N--E--V--N

---------------------------------------------------------------------------------------------><-----
--Q--G--D--A--L--E--H--N--F--S--A--I--Y--G--A--L--T--L--P--V--N--H--I--F--S--E--Q--R--F--P--V--A--T-
TCAAGGTGATGCCTTAGAACATAATTTTAGTGCCATCTATGGTGCATTGACTTTACCAGTAAACCACATTTTTTCAGAACAGAGATTTCCAGTGGCCACC
:::::::::::::::::::::::::::::::::::::::::::::::::::.::::::.:::::::.:::::::::: :::.:.: ::::::::      
TCAAGGTGATGCCTTAGAACATAATTTTAGTGCCATCTATGGTGCATTGACCTTACCAATAAACCATATTTTTTCAGCACAAAAAATTCCAGTG------
--Q--G--D--A--L--E--H--N--F--S--A--I--Y--G--A--L--T--L--P--I--N--H--I--F--S--A--Q--K--I--P--V-------

----------------------------------------------------------------------------------------------------
-M--K--T--L--L--R--T--W--S--E--L--Y--R--A--F--A--R--C--A--A--L--V--A--T--A--E--E--N--L--C--C--E--E--
ATGAAGACTTTGCTTAGAACTTGGTCAGAATTATATAGAGCATTTGCTCGTTGTGCTGCTTTGGTGGCAACAGCAGAAGAGAACTTGTGCTGTGAGGAAC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-------------------------------------------><-------------------------------------------------------
L--S--S--K--I--M--S--S--L--E--D--E--G--F--S--N--L--L--F--V--D--R--I--I--Y--I--I--T--V--M--V--D--C--I
TTTCTTCCAAGATAATGTCCAGTTTGGAAGATGAAGGCTTTTCTAATTTGTTGTTCGTGGATAGAATTATTTATATTATTACTGTAATGGTTGATTGCAT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-------------------------------------------><-------------------------------------------------------
--D--F--S--P--Y--N--I--K--Y--Q--P--K--V--K--S--P--Q--R--P--S--D--W--S--K--K--K--N--E--P--L--G--K--L-
TGACTTCTCACCATATAATATTAAATATCAGCCCAAAGTTAAATCACCACAGAGACCTTCAGATTGGTCCAAAAAGAAGAATGAGCCCCTAGGGAAATTG
                                              ::::::::::::::::::::::::::::::::::: ::::::::.::.::::::
----------------------------------------------CCACAGAGACCTTCAGATTGGTCCAAAAAGAAGAAGGAGCCCCTGGGAAAATTG
-----------------------------------------------P--Q--R--P--S--D--W--S--K--K--K--K--E--P--L--G--K--L-

----------------------------------------------------------------------------------------------------
-T--S--L--F--K--L--I--V--K--V--I--Y--S--F--H--T--L--S--F--K--E--A--H--S--D--T--L--F--T--I--G--N--S--
ACTTCTTTATTTAAACTTATTGTGAAAGTGATCTATTCTTTCCACACACTGAGCTTCAAGGAAGCACATTCTGATACCCTCTTCACTATTGGCAACTCAA
.::::::::::::::::::::::.:.:::::::::.::::::::::: ::::::.:::::::::.::::: ::::::.:::.:::.:::.::::::::::
GCTTCTTTATTTAAACTTATTGTAAGAGTGATCTACTCTTTCCACACTCTGAGCCTCAAGGAAGTACATTGTGATACTCTCCTCATTATCGGCAACTCAA
-A--S--L--F--K--L--I--V--R--V--I--Y--S--F--H--T--L--S--L--K--E--V--H--C--D--T--L--L--I--I--G--N--S--

----------------------------------------------------------------------------------------------------
I--T--G--I--I--S--S--V--L--G--H--I--S--L--P--S--M--I--R--K--I--F--A--T--L--T--R--P--L--A--L--F--Y--E
TCACCGGCATTATTTCCAGTGTACTTGGGCATATTTCTTTGCCTTCTATGATCCGAAAAATATTTGCAACTTTAACAAGACCTCTGGCATTATTTTATGA
:::.:.::::: ::::::.:::::::::.:::::::::::::::::::::::::::::::::::::::::::::::::.::: ::::..:::::::::::
TCATCAGCATTCTTTCCAATGTACTTGGACATATTTCTTTGCCTTCTATGATCCGAAAAATATTTGCAACTTTAACAAAACCACTGGTGTTATTTTATGA
I--I--S--I--L--S--N--V--L--G--H--I--S--L--P--S--M--I--R--K--I--F--A--T--L--T--K--P--L--V--L--F--Y--E

--------><-----------------------------------------><-----------------------------------------------
--N--S--K--L--D--E--V--P--K--V--Y--S--C--L--N--N--K--L--E--K--L--L--G--E--I--I--A--C--L--Q--F--S--Y-
AAACTCAAAGCTTGATGAAGTTCCTAAAGTATATAGTTGTCTGAACAACAAGTTAGAAAAGCTACTGGGAGAAATTATTGCTTGTCTGCAATTCAGCTAC
:::::::                                                :::::::::::.::::::::::: :::::.::.::  ::::::::
AAACTCA------------------------------------------------GAAAAGCTACTAGGAGAAATTAT-GCTTGCCTACACATCAGCTAC
--N--S--------------------------------------------------E--K--L--L--G--E--I--I--A--C--L--H--I--S--Y-

----------------------------------------------------------------------------------------------------
-T--G--T--Y--D--S--E--L--L--E--Q--L--S--P--L--L--C--I--I--F--L--H--K--N--K--Q--I--R--K--Q--S--A--Q--
ACCGGAACTTATGATAGTGAACTTCTTGAACAACTCTCCCCACTATTATGCATAATATTTCTGCACAAGAATAAACAGATTCGAAAACAGAGTGCTCAGT
::.: :::::::::.:: :.  ::::::::::. :::: :::.:.:::::..::::::::...:::::::::::::::::: :::::::.::::::::::
ACTGTAACTTATGACAGGGG-ATTCTTGAACAGATCTCGCCATTGTTATGTGTAATATTTTCACACAAGAATAAACAGATTAGAAAACAAAGTGCTCAGT
-T--V--T--Y--D--R--E--I--L--E--Q--I--S--P--L--L--C--V--I--F--S--H--K--N--K--Q--I--R--K--Q--S--A--Q--

------------------------------------------------------------><--------------------------------------
F--W--N--A--T--F--A--K--V--M--M--L--V--Y--P--E--E--L--K--P--V--L--T--Q--A--K--Q--K--F--L--L--L--L--P
TCTGGAATGCCACTTTTGCCAAAGTGATGATGTTGGTTTATCCTGAAGAGTTAAAACCAGTACTAACACAAGCCAAACAAAAATTTCTGCTCCTGTTGCC
::::::::::::: :::::.::::: ...::::::.::::::::::.::::::   ::::::::::  :::::::::::.::::.::::::.::.:  :.
TCTGGAATGCCACATTTGCTAAAGTCGCAATGTTGATTTATCCTGAGGAGTTA---CCAGTACTAAG-CAAGCCAAACAGAAATCTCTGCTTCTATG-CT
F--W--N--A--T--F--A--K--V--A--M--L--I--Y--P--E--E--L-----P--V--L--T--Q--A--K--Q--K--S--L--L--L--L--P

------------------------------------------------------------------------><--------------------------
--G--L--E--T--V--E--M--M--E--E--S--S--G--P--Y--S--D--G--T--E--N--S--Q--L--N--V--K--I--S--G--M--E--R-
TGGTTTGGAAACTGTTGAAATGATGGAGGAATCCAGTGGACCATATTCTGATGGAACAGAAAATTCACAACTAAATGTGAAGATAAGTGGCATGGAGAGA
 :: :::::::. :::::::: :::::.:::::::::::::::::::: :::                                                
-GGATTGGAAAT-GTTGAAATTATGGAAGAATCCAGTGGACCATATTCAGAT------------------------------------------------
--G--L--E--T--V--E--I--M--E--E--S--S--G--P--Y--S--D-------------------------------------------------

--------------------------------------------------------------------------------------------><------
-K--S--N--G--K--R--D--S--F--L--A--Q--T--K--N--K--K--E--N--M--K--P--A--A--K--L--K--L--E--S--S--S--L--
AAATCAAATGGAAAAAGAGATTCATTTTTGGCACAAACAAAGAATAAAAAAGAAAATATGAAACCAGCAGCCAAACTGAAACTTGAATCTTCGTCTTTAA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
K--V--K--G--E--I--L--L--E--E--E--K--S--T--D--F--V--F--I--P--P--E--G--K--D--A--K--E--R--I--L--T--D--H
AAGTAAAGGGTGAAATTCTTTTGGAAGAGGAAAAGTCTACTGACTTTGTGTTTATACCTCCAGAAGGAAAAGATGCAAAGGAAAGAATATTAACTGATCA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

--------------------------------------------><------------------------------------------------------
--Q--K--E--V--L--K--T--K--R--C--D--I--P--A--M--Y--N--N--L--D--V--S--Q--D--T--L--F--T--Q--Y--S--Q--E-
TCAAAAAGAAGTTCTCAAAACAAAGCGGTGTGATATTCCTGCCATGTATAATAATCTGGATGTTTCCCAAGATACCTTATTTACTCAGTATAGTCAGGAA
                            :::::::::::::::::::::::::::::::::::::: ::::::::.:::::: ::::.::::::::::::
----------------------------TGTGATATTCCTGCCATGTATAATAATCTGGATGTTTCACAAGATACTTTATTTTCTCAATATAGTCAGGAA
-----------------------------C--D--I--P--A--M--Y--N--N--L--D--V--S--Q--D--T--L--F--S--Q--Y--S--Q--E-

-------------------------><-----------------------------------------------------><------------------
-E--P--M--E--I--P--T--L--T--R--K--P--K--E--D--S--K--M--M--I--T--E--E--Q--M--D--S--D--I--V--I--P--Q--
GAGCCTATGGAAATTCCTACTTTAACCAGAAAACCAAAGGAGGATTCTAAGATGATGATTACGGAGGAGCAAATGGACAGTGACATTGTCATTCCTCAAG
::.                                                                                                 
GAA-------------------------------------------------------------------------------------------------
-E--------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
D--V--T--E--D--C--G--M--A--E--H--L--E--K--S--S--L--S--N--N--E--C--G--S--L--D--K--T--S--P--E--M--S--N
ATGTCACGGAAGACTGTGGTATGGCTGAACATCTTGAAAAGTCCTCCCTTTCGAATAATGAGTGTGGTTCTCTTGACAAAACCAGTCCAGAAATGTCAAA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--S--N--N--D--E--R--K--K--A--L--I--S--S--R--K--T--S--T--E--C--A--S--S--T--E--N--S--F--V--V--S--S--S-
CAGTAATAATGATGAAAGAAAAAAAGCTTTAATTTCATCAAGGAAAACATCAACTGAATGTGCATCTAGTACAGAAAATTCTTTCGTTGTCAGCAGTAGT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-S--V--S--N--T--T--V--A--G--T--P--P--Y--P--T--S--R--R--Q--T--F--I--T--L--E--K--F--D--G--S--E--N--R--
TCAGTTTCTAATACCACTGTTGCTGGAACTCCCCCATACCCTACAAGTCGGAGGCAAACCTTTATTACTTTGGAGAAGTTTGATGGTTCAGAAAATAGAC
                                                                                    ::::::::::::::::
------------------------------------------------------------------------------------GGTTCAGAAAATAGAC
-------------------------------------------------------------------------------------G--S--E--N--R--

----------------------------------------------------------------------------------------------------
P--F--S--P--S--P--L--N--N--I--S--S--T--V--T--V--K--N--N--Q--E--T--M--I--K--T--D--F--L--P--K--A--K--Q
CTTTTAGTCCATCCCCCTTGAATAATATTTCATCAACTGTTACAGTGAAAAATAACCAGGAAACCATGATTAAAACAGATTTTCTACCAAAAGCAAAGCA
:::::::::::::::: ::.:::.:::: :::::::::::::::::::::::::.:::::::. ::..:.:::.::::::  ::.:.::::::::::: :
CTTTTAGTCCATCCCCATTAAATGATATGTCATCAACTGTTACAGTGAAAAATAGCCAGGAAGGCACAACTAAGACAGATAATCCATCAAAAGCAAAGAA
P--F--S--P--S--P--L--N--D--M--S--S--T--V--T--V--K--N--S--Q--E--G--T--T--K--T--D--N--P--S--K--A--K--K

----------------------------------------------------------------------------------------------------
--R--E--G--T--F--S--K--S--D--S--E--K--I--V--N--G--T--K--R--S--S--R--R--A--G--K--A--E--Q--T--G--N--K-
AAGAGAAGGGACTTTTTCAAAATCTGATTCTGAAAAAATAGTGAATGGAACTAAGAGATCAAGCCGGAGAGCTGGTAAAGCTGAACAAACAGGGAATAAA
:. .      ..:.:::.: :::::::.::::::::::::::: ::::.:.::::::::::.::::.:.: : .:::.. :::::: :::::::::::::
AGTG------GTTCTTTTACAATCTGACTCTGAAAAAATAGTGCATGGGATTAAGAGATCAGGCCGAAAATCAAGTAGGTCTGAACCAACAGGGAATAAA
--V--------V--L--L--Q--S--D--S--E--K--I--V--H--G--I--K--R--S--G--R--K--S--S--R--S--E--P--T--G--N--K-

----------------------------------------------------------------------------------------------------
-R--S--K--P--L--M--R--S--E--P--E--K--N--T--E--E--S--V--E--G--I--V--V--L--E--N--N--P--P--G--L--L--N--
AGGTCTAAGCCCTTAATGAGATCTGAGCCGGAGAAAAATACTGAGGAATCTGTTGAAGGCATTGTAGTCTTAGAAAATAACCCACCTGGTTTGCTTAATC
:..::::::::::::::::::::::: : ::::::::.:::: .::::::. :::: ::::: ::::.::::::::::::.:::::::::::::::::: 
AAATCTAAGCCCTTAATGAGATCTGATCAGGAGAAAAGTACTCGGGAATCCTTTGATGGCATGGTAGCCTTAGAAAATAATCCACCTGGTTTGCTTAATG
-K--S--K--P--L--M--R--S--D--Q--E--K--S--T--R--E--S--F--D--G--M--V--A--L--E--N--N--P--P--G--L--L--N--

----------------------------------------------------------------------------------------------------
Q--T--E--C--V--S--D--N--Q--V--H--L--S--E--S--T--M--E--H--D--N--T--K--L--K--A--A--T--V--E--N--A--V--L
AAACAGAATGTGTGTCAGATAATCAGGTTCATCTTTCTGAATCTACAATGGAGCATGACAATACAAAGCTTAAAGCAGCAACAGTGGAAAATGCTGTATT
:::::::::::::::.:::: :::::::::::::.:::::::::.::.:::::.:::. .:::::: ::::::.    :::::::.::::::::.:::::
AAACAGAATGTGTGTTAGATCATCAGGTTCATCTCTCTGAATCTGCAGTGGAGTATGGGGATACAACGCTTAAG---CCAACAGTAGAAAATGCCGTATT
E--T--E--C--V--L--D--H--Q--V--H--L--S--E--S--A--V--E--Y--G--D--T--T--L--K-----P--T--V--E--N--A--V--L

----------------------------------------------------------------------------------------------------
--L--E--T--N--T--V--E--E--K--N--V--E--I--N--L--E--S--K--E--N--T--P--P--V--V--I--S--A--D--Q--M--V--N-
ATTGGAAACTAATACTGTAGAGGAGAAAAATGTAGAAATTAATTTGGAATCCAAAGAGAATACACCCCCAGTAGTAATATCAGCAGATCAAATGGTAAAT
:::.:::: .:.:::::::::.:: ::::.. :::::::::::::::::::::::::.:::::::::::::.:.:::.: :::::::::: :..::::::
ATTAGAAAGCAGTACTGTAGAAGACAAAAGCTTAGAAATTAATTTGGAATCCAAAGAAAATACACCCCCAGCAATAACAACAGCAGATCACACAGTAAAT
--L--E--S--S--T--V--E--D--K--S--L--E--I--N--L--E--S--K--E--N--T--P--P--A--I--T--T--A--D--H--T--V--N-

----------------------------------------------------------------------------------------------------
-E--D--S--Q--V--Q--I--T--P--N--Q--K--T--L--R--R--S--S--R--R--R--S--E--V--V--E--S--T--T--E--S--Q--D--
GAGGATAGTCAGGTTCAGATAACTCCAAATCAGAAAACCCTTAGACGGTCTTCAAGGCGACGTTCAGAAGTAGTAGAGTCTACCACTGAAAGCCAAGATA
::::::::::: ::::::.:::::.:::::::.::::: :::::.::.::::.:::: :::::::::::.. ..::::.: .::::::: ::::::::::
GAGGATAGTCATGTTCAGGTAACTTCAAATCAAAAAACGCTTAGGCGATCTTTAAGGAGACGTTCAGAAAC-ACAGAGCCAGCCACTGATAGCCAAGATA
-E--D--S--H--V--Q--V--T--S--N--Q--K--T--L--R--R--S--L--R--R--R--S--E--I--T--E--P--A--T--D--S--Q--D--

----------------------------------------------------------------------------------------------------
K--E--N--S--H--Q--K--K--E--R--R--K--E--E--E--K--P--L--Q--K--S--P--L--H--I--K--D--D--V--L--P--K--Q--K
AGGAAAATAGTCATCAAAAAAAGGAACGACGTAAGGAAGAAGAAAAACCTCTTCAGAAGAGTCCATTGCATATAAAAGATGATGTGTTACCTAAACAAAA
:.:::::::.:::::: ::::.:::. :::: ::::::::::::::. :::: ::::::                                         
AAGAAAATAATCATCA-AAAAGGGAGAGACGAAAGGAAGAAGAAAAGACTCTGCAGAAG-----------------------------------------
K--E--N--N--H--Q--K--R--E--R--R--K--E--E--E--K--T--L--Q--K------------------------------------------

----------------------------------------------------------------------------------------------------
--L--I--A--E--Q--T--L--Q--E--N--L--I--E--K--G--S--N--L--H--E--K--T--L--G--E--T--S--A--N--A--E--T--E-
ACTGATTGCTGAACAAACTCTACAGGAGAATTTAATTGAGAAAGGAAGTAATTTACATGAGAAGACTCTTGGGGAAACTAGTGCTAATGCAGAAACTGAA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-Q--N--K--K--K--A--D--P--E--N--I--K--S--E--G--D--G--T--Q--D--I--V--D--K--S--S--E--K--L--V--R--G--R--
CAAAATAAAAAAAAGGCAGACCCTGAGAACATTAAGTCTGAGGGGGATGGTACCCAGGACATTGTAGATAAGTCCTCTGAGAAACTAGTCAGAGGCCGAA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
T--R--Y--Q--T--R--R--A--S--Q--G--L--L--S--S--I--E--N--S--E--S--D--S--S--E--A--K--E--E--G--S--R--K--K
CACGGTATCAAACTAGAAGAGCATCTCAGGGTTTGCTTTCCAGCATTGAAAACTCAGAATCTGATAGTTCGGAGGCAAAAGAAGAAGGTTCTAGGAAGAA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--R--S--G--K--W--K--N--K--S--N--E--S--V--D--I--Q--D--Q--E--E--K--V--V--K--Q--E--C--I--K--A--E--N--Q-
GAGATCTGGAAAATGGAAAAACAAAAGCAATGAAAGTGTTGACATTCAAGATCAAGAAGAGAAAGTGGTGAAACAGGAATGTATAAAAGCTGAAAATCAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-S--H--D--Y--K--A--T--S--E--E--D--V--S--I--K--S--P--I--C--E--K--Q--D--E--S--N--T--V--I--C--Q--D--S--
TCACATGATTATAAAGCAACTTCTGAAGAAGATGTAAGCATAAAATCTCCGATTTGCGAAAAACAAGATGAAAGTAATACTGTAATATGTCAGGATTCTA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
T--V--T--S--D--L--L--Q--V--P--D--D--L--P--N--V--C--E--E--K--N--E--T--S--K--Y--A--E--Y--S--F--T--S--L
CAGTAACTTCAGATTTGTTGCAAGTTCCTGATGATTTACCAAATGTGTGTGAGGAAAAAAATGAAACTAGCAAATATGCAGAATATTCCTTTACAAGTCT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--P--V--P--E--S--N--L--R--T--R--N--A--I--K--R--L--H--K--R--D--S--F--D--N--C--S--L--G--E--S--S--K--I-
ACCTGTGCCAGAATCAAATCTAAGGACTAGAAATGCCATTAAGAGATTACATAAGCGAGACTCTTTTGATAATTGTAGTTTGGGAGAATCCTCAAAAATA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-G--I--S--D--I--S--S--L--S--E--K--T--F--Q--T--L--E--C--Q--H--K--R--S--R--R--V--R--R--S--K--G--C--D--
GGGATATCAGATATTTCTTCGCTTTCAGAAAAAACTTTTCAAACACTTGAATGCCAACACAAGAGAAGTAGGAGGGTGAGGAGATCTAAAGGTTGTGATT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
C--C--G--E--K--S--Q--P--Q--E--K--S--L--I--G--L--K--N--T--E--N--N--D--V--E--I--S--E--T--K--K--A--D--V
GCTGTGGGGAAAAATCACAACCTCAGGAAAAGTCACTCATTGGGTTAAAGAATACAGAAAATAATGACGTAGAGATTAGTGAAACAAAAAAGGCAGATGT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--Q--A--P--V--S--P--S--E--T--S--Q--A--N--P--Y--S--E--G--Q--F--L--D--E--H--H--S--V--N--F--H--L--G--L-
GCAAGCACCTGTAAGCCCATCAGAAACTTCTCAAGCTAATCCATATTCTGAAGGACAATTTTTAGATGAACATCATAGTGTGAATTTTCATTTGGGTCTC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-K--E--D--N--D--T--I--N--D--S--L--I--V--S--E--T--K--S--K--E--N--T--M--Q--E--S--L--P--S--G--I--V--N--
AAAGAGGATAATGATACTATTAATGATTCATTAATTGTTTCTGAAACCAAATCAAAAGAAAACACTATGCAAGAATCTCTTCCTTCTGGAATAGTAAACT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
F--R--E--E--I--C--D--M--D--S--S--E--A--M--S--L--E--S--Q--E--S--P--N--E--N--F--K--T--V--G--P--C--L--G
TTAGAGAGGAAATTTGTGATATGGATTCTAGTGAAGCAATGTCTCTTGAAAGCCAGGAGTCACCTAATGAAAATTTTAAAACTGTTGGCCCGTGTTTAGG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--D--S--K--N--V--S--Q--E--S--L--E--T--K--E--E--K--P--E--E--T--P--K--M--E--L--S--L--E--N--V--T--V--E-
AGACTCGAAAAATGTTTCACAGGAATCTTTGGAGACAAAAGAAGAAAAACCAGAAGAAACCCCAAAAATGGAACTGAGTCTAGAGAATGTTACTGTTGAA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-G--N--A--C--K--V--T--E--S--N--L--E--K--A--K--T--M--E--L--N--V--G--N--E--A--S--F--H--G--Q--E--R--T--
GGAAATGCATGTAAAGTAACAGAATCCAATCTAGAGAAAGCAAAAACTATGGAATTGAATGTAGGAAATGAAGCTAGCTTTCATGGACAAGAGAGAACCA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
K--T--G--I--S--E--E--A--A--I--E--E--N--K--R--N--D--D--S--E--A--D--T--A--K--L--N--A--K--E--V--A--T--E
AAACTGGTATTTCTGAAGAAGCAGCAATAGAAGAAAATAAAAGAAATGATGACTCTGAAGCAGACACAGCTAAACTGAATGCCAAAGAAGTAGCAACTGA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--E--F--N--S--D--I--S--L--S--D--N--T--T--P--V--K--L--N--A--Q--T--E--I--S--E--Q--T--A--A--G--E--L--D-
GGAATTTAATTCAGATATTAGTCTTTCTGATAATACTACACCTGTAAAATTGAATGCTCAAACTGAGATTTCTGAACAAACAGCAGCTGGGGAACTAGAT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-G--G--N--D--V--S--D--L--H--S--S--E--E--T--N--T--K--M--K--N--N--E--E--M--M--I--G--E--A--M--A--E--T--
GGAGGAAATGATGTATCTGATCTACACTCATCTGAAGAAACGAATACCAAAATGAAAAATAATGAAGAAATGATGATCGGCGAGGCAATGGCTGAAACTG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
G--H--D--G--E--T--E--N--E--G--I--T--T--K--T--S--K--P--D--E--A--E--T--N--M--L--T--A--E--M--D--N--F--V
GCCATGATGGTGAAACAGAGAATGAGGGCATAACTACCAAAACCTCAAAGCCTGATGAAGCTGAAACAAACATGTTGACTGCAGAAATGGACAACTTTGT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--C--D--T--V--E--M--S--T--E--E--G--I--I--D--A--N--K--T--E--T--N--T--E--Y--S--K--S--E--E--K--L--D--N-
TTGTGACACAGTTGAAATGAGCACTGAAGAAGGAATCATTGACGCTAATAAAACTGAAACAAATACTGAGTATAGTAAATCTGAAGAAAAATTAGATAAC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-N--Q--M--V--M--E--S--D--I--L--Q--E--D--H--H--T--S--Q--K--V--E--E--P--S--Q--C--L--A--S--G--T--A--I--
AATCAAATGGTAATGGAAAGTGATATTTTACAGGAAGATCACCATACTTCACAGAAAGTGGAGGAACCATCACAGTGTCTGGCATCTGGAACAGCTATCT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
S--E--L--I--I--E--D--N--N--A--S--P--Q--K--L--R--E--L--D--P--S--L--V--S--A--N--D--S--P--S--G--M--Q--T
CTGAGCTAATAATAGAAGACAATAATGCATCTCCTCAAAAACTAAGGGAACTTGATCCTTCACTTGTGTCAGCAAATGACAGTCCTAGTGGCATGCAGAC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--R--C--V--W--S--P--L--A--S--P--S--T--S--I--L--K--R--G--L--K--R--S--Q--E--D--E--I--S--S--P--V--N--K-
ACGCTGTGTCTGGTCTCCTTTGGCTTCTCCGTCTACGAGCATTTTAAAGAGAGGACTAAAAAGATCCCAAGAAGATGAAATCTCATCACCTGTTAATAAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-----------------------><---------------------------------------------------------------------------
-V--R--R--V--S--F--A--D--P--I--Y--Q--A--G--L--A--D--D--I--D--R--R--C--S--I--V--R--S--H--S--S--N--S--
GTTCGCCGTGTCTCCTTTGCAGATCCAATATACCAAGCAGGATTGGCAGATGACATTGATAGACGGTGCTCTATTGTTAGGTCCCATTCTTCCAATAGTT
::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::.::.:::::::::.: :::: ::::::::: :::::::
GTTCGCCGTGTCTCCTTTGCAGATCCAATATACCAAGCAGGATTGGCAGATGACATTGATAGGCGATGCTCTATTATAAGGTGCCATTCTTCAAATAGTT
-V--R--R--V--S--F--A--D--P--I--Y--Q--A--G--L--A--D--D--I--D--R--R--C--S--I--I--R--C--H--S--S--N--S--

----------------------------------------------------------------------><----------------------------
S--P--I--G--K--S--V--K--T--S--P--T--T--Q--S--K--H--N--T--T--S--A--K--G--F--L--S--P--G--S--R--S--P--K
CTCCCATAGGAAAAAGTGTTAAAACTTCTCCTACTACACAATCTAAGCATAATACCACTTCAGCCAAAGGATTTCTGTCCCCAGGATCACGTAGCCCTAA
::.::::.: ::::::::.::::::::: ::.:::.:::: :::::::::::::::::::::.:::::::::::::::::::::::::::::::::::::
CTTCCATGGTAAAAAGTGCTAAAACTTCACCCACTGCACATTCTAAGCATAATACCACTTCAACCAAAGGATTTCTGTCCCCAGGATCACGTAGCCCTAA
S--S--M--V--K--S--A--K--T--S--P--T--A--H--S--K--H--N--T--T--S--T--K--G--F--L--S--P--G--S--R--S--P--K

------------------------------------------------><--------------------------------------------------
--F--K--S--S--K--K--C--L--I--S--E--M--A--K--E--S--I--P--C--P--T--E--S--V--Y--P--P--L--V--N--C--V--A-
ATTTAAGAGCTCAAAGAAGTGTTTAATTTCAGAAATGGCCAAAGAATCCATACCATGCCCAACAGAAAGTGTTTACCCACCATTGGTGAACTGTGTGGCA
:::::::::::::::::::::::::::: ::::::::::.::.:::::..:.:::::::: :::::::::::::::::  : :::::::::::::..:::
ATTTAAGAGCTCAAAGAAGTGTTTAATTGCAGAAATGGCTAAGGAATCTGTGCCATGCCCCACAGAAAGTGTTTACCCTGCCTTGGTGAACTGTGCAGCA
--F--K--S--S--K--K--C--L--I--A--E--M--A--K--E--S--V--P--C--P--T--E--S--V--Y--P--A--L--V--N--C--A--A-

----------------------------------------------------------------><----------------------------------
-P--V--D--I--I--L--P--Q--I--T--S--N--M--W--A--R--G--L--G--Q--L--I--R--A--K--N--I--K--T--I--G--D--L--
CCAGTTGACATCATTTTACCTCAGATTACATCAAACATGTGGGCAAGAGGCCTGGGACAACTCATTAGAGCTAAGAATATAAAAACTATTGGTGATTTGA
::.::::::::::::::::: ::::::::.:: ::::::   :::::::: ::::::::::::::::::::.:::::::::::::: :::::::::::::
CCGGTTGACATCATTTTACCGCAGATTACGTCCAACATG---GCAAGAGGACTGGGACAACTCATTAGAGCCAAGAATATAAAAACAATTGGTGATTTGA
-P--V--D--I--I--L--P--Q--I--T--S--N--M-----A--R--G--L--G--Q--L--I--R--A--K--N--I--K--T--I--G--D--L--

----------------------------------------------------------------------------------------------------
S--T--L--T--A--S--E--I--K--T--L--P--I--R--S--P--K--V--S--N--V--K--K--A--L--R--I--Y--H--E--Q--Q--V--K
GTACTCTTACAGCATCTGAAATAAAAACTCTTCCTATCCGTTCTCCAAAAGTGTCCAATGTAAAAAAGGCTCTCAGAATATATCATGAGCAGCAGGTGAA
:::::::::::::::::::::::::::::::.:::::::::::::::::::::::.:::::::::::::: ::::::.::::::::::::::::::::::
GTACTCTTACAGCATCTGAAATAAAAACTCTCCCTATCCGTTCTCCAAAAGTGTCTAATGTAAAAAAGGCACTCAGAGTATATCATGAGCAGCAGGTGAA
S--T--L--T--A--S--E--I--K--T--L--P--I--R--S--P--K--V--S--N--V--K--K--A--L--R--V--Y--H--E--Q--Q--V--K

------------------><--------------------------------------------------------------------------------
--T--R--G--L--E--E--I--P--V--F--D--I--S--E--K--T--V--N--G--I--E--N--K--S--L--S--P--D--E--E--R--L--V-
GACTCGTGGACTAGAAGAGATTCCAGTTTTTGATATTTCTGAAAAAACAGTAAATGGAATAGAAAATAAATCTTTGTCACCTGATGAAGAAAGACTTGTC
: :::::::::::::::::::::::::::::::::::::::::::::::.::::::::::.:::::::::::: : :: :::::::::::::::::::.:
GTCTCGTGGACTAGAAGAGATTCCAGTTTTTGATATTTCTGAAAAAACAATAAATGGAATGGAAAATAAATCTGTTTCTCCTGATGAAGAAAGACTTGCC
--S--R--G--L--E--E--I--P--V--F--D--I--S--E--K--T--I--N--G--M--E--N--K--S--V--S--P--D--E--E--R--L--A-

---------------------------><-----------------------------------------------------------------------
-S--D--I--I--D--P--V--A--L--E--I--P--L--S--K--N--L--L--A--Q--I--S--A--L--A--L--Q--L--D--S--E--D--L--
TCAGATATAATTGATCCTGTTGCTTTAGAAATTCCATTATCCAAAAACCTTCTGGCACAGATTAGTGCTCTTGCTCTTCAGCTGGATTCAGAAGATCTTC
:::    ::::::::::::::::::::::::.:::::::::.::::::::: :::::::::::::::: ::.::::::::::::::::::::::::::.:
TCA---TTAATTGATCCTGTTGCTTTAGAAACTCCATTATCTAAAAACCTTGTGGCACAGATTAGTGCACTCGCTCTTCAGCTGGATTCAGAAGATCTCC
-S-----L--I--D--P--V--A--L--E--T--P--L--S--K--N--L--V--A--Q--I--S--A--L--A--L--Q--L--D--S--E--D--L--

----------------------------------------------------------------------------------------------------
H--N--Y--S--G--S--Q--L--F--E--M--H--E--K--L--S--C--M--A--N--S--V--I--K--N--L--Q--S--R--W--R--S--P--S
ATAATTATTCAGGAAGCCAACTATTTGAAATGCACGAGAAACTAAGTTGTATGGCAAACTCTGTAATAAAAAATCTACAGTCACGTTGGAGATCACCATC
::::::::::::::::.::..::::.::::::::.:::::::: .:: :.:::::::::: :.:::: :::::::: ::::::::::::::.:::::: :
ATAATTATTCAGGAAGTCAGTTATTCGAAATGCATGAGAAACTTGGTAGCATGGCAAACTGTATAATTAAAAATCTTCAGTCACGTTGGAGGTCACCAGC
H--N--Y--S--G--S--Q--L--F--E--M--H--E--K--L--G--S--M--A--N--C--I--I--K--N--L--Q--S--R--W--R--S--P--A

-------------------
--H--E--N--S--I--*-
CCATGAAAATTCTATTTAG
:::::::::::::::::::
CCATGAAAATTCTATTTAG
--H--E--N--S--I--*-

Pig Consensus Sequence

>BGISUST0000899841
----------------------------------------------------------------------------------------------------
-----------------------------------ATTATAGAAATTGAGAAAAAACTTCCTCGGCTCTTCAAAGTTTTAAAG---CACATAACCAGTCA
AAACTCAGAGCTCAGTAGTGCTGCTCTACAGGCCTTGGGGTTTTGCTTATATAATCCTAAAATTACATCAGCATTATCA---------------GAACTG
CTTTCAAAACTGAATGATACTATTAAGAGTTCAGATAAAAATGTTCGTACTAGGGCACTTTGGGTGATATCCAAGCAGACGTTTCCCCCTGAAGTTCTTG
GCAAA-----------------------------------------------------------------------------------------------
----CTAATTGAACAAGCCCCAATTCAAATGGGGGAAGAGTCAATTACGTGGGCAAAAGTGGTCATACCT------------------------------
---------------------------------------------------------------------------------------------AAATTAC
TTTCAGAACTCCAGAAGCTATTTATGAGTAAAAATGAGACGTATGTGTTAAAATTATGGCCTTTGTTTGTCAAGCTTCTTGGGAAG--------------
----------------------------------------------------------------------------------------------------
---------------------------ATACTATGTAGTGCAAAAAGACTGAAGTTGTTAATGCAACCTTTGAGTTCTATCCATGTGAGAACAGAAGCTC
TAGCACTGACAAAACTAGAAGTCTGGTGGTATCTATTG---------------------------------------GTTTGTGTGCCTCTGATTCAAAG
CACAATAAGCATCGATTCTAATGCTTCACCTCAAGGCAGTTCATCTCGTGTAGCTACTTCTCCAGGTTTAAATCCTATGACTCCTGTACACAAA------
----------------------------------------------------------------------------------------------------
--------------------------------------------------------------------------CCACTTGAACATCCATTAATCAGCAG
CTCTTCTTTTTTTTCCAAACATGCTAATACACTTATCACCGCTGTTCATGATAGTTTTGTTGCAGTTGGGAAAGAT------------------------
------------------------------------------------AACAGAAAAGAGAGGCCCGGTTCTGAAGTTTTGACCCTCTTATTAAAATGTC
TAGAAAGTATAGTGAAGTCAGAAGTATTTCCTGTATCAAAAATGCTGGTCCTCATGGAAATTACAATTAAAGGACTTCCTCAGAAAGTATTAGGTTCTCC
AGCATATCAGGTTGCTAATATGGATATTCTTAATGGAACTCCTGCTTTGTTCTTAATTCAGTTAATTTTCAATAATAATCTGGAATGTGGTGTAGAAGAT
GAA---TTTTTTCTCAGCCTGGAAACTCTTGTAGGTAGTGTTCTTTCTGGTCCAACTTCACCACTAGCTTTCAGCGACTCCGTCTTAAATGTTATTAACC
AAAATGCAAAGCAGTTGGAAAACAAGGAGCATCTTTGGAGAATGTGGAGTATTATAGTCACC------------------------ACCAATGAAGTGAA
TCAAGGTGATGCCTTAGAACATAATTTTAGTGCCATCTATGGTGCATTGACCTTACCAATAAACCATATTTTTTCAGCACAAAAAATTCCAGTG------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------CCACAGAGACCTTCAGATTGGTCCAAAAAGAAGAAGGAGCCCCTGGGAAAATTG
GCTTCTTTATTTAAACTTATTGTAAGAGTGATCTACTCTTTCCACACTCTGAGCCTCAAGGAAGTACATTGTGATACTCTCCTCATTATCGGCAACTCAA
TCATCAGCATTCTTTCCAATGTACTTGGACATATTTCTTTGCCTTCTATGATCCGAAAAATATTTGCAACTTTAACAAAACCACTGGTGTTATTTTATGA
AAACTCA------------------------------------------------GAAAAGCTACTAGGAGAAATtgCTTGCCTACACATCAGCTACACT
GTAACTTATGACAGgaTTCTTGAACAGATCTCGCCATTGTTATGTGTAATATTTTCACACAAGAATAAACAGATTAGAAAACAAAGTGCTCAGTTCTGGA
ATGCCACATTTGCTAAAGTCGCAATGTTGATTTATCCTGAGGAGTTA---CCAGTACTacAAGCCAAACAGAAATCTCTGCTTCTagGATTGGAagTTGA
AATTATGGAAGAATCCAGTGGACCATATTCAGAT------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------TGTGATATTCCTGCCATGTATAATAATCTGGATGTTTCACAAGATACTTTATTTTCTCAATATAGTCAGGAAGAA---------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
------------------------------------------------------------------GGTTCAGAAAATAGACCTTTTAGTCCATCCCCAT
TAAATGATATGTCATCAACTGTTACAGTGAAAAATAGCCAGGAAGGCACAACTAAGACAGATAATCCATCAAAAGCAAAGAAAGTGGTTCTTTTACAATC
TGACTCTGAAAAAATAGTGCATGGGATTAAGAGATCAGGCCGAAAATCAAGTAGGTCTGAACCAACAGGGAATAAAAAATCTAAGCCCTTAATGAGATCT
GATCAGGAGAAAAGTACTCGGGAATCCTTTGATGGCATGGTAGCCTTAGAAAATAATCCACCTGGTTTGCTTAATGAAACAGAATGTGTGTTAGATCATC
AGGTTCATCTCTCTGAATCTGCAGTGGAGTATGGGGATACAACGCTTAAGCCAACAGTAGAAAATGCCGTATTATTAGAAAGCAGTACTGTAGAAGACAA
AAGCTTAGAAATTAATTTGGAATCCAAAGAAAATACACCCCCAGCAATAACAACAGCAGATCACACAGTAAATGAGGATAGTCATGTTCAGGTAACTTCA
AATCAAAAAACGCTTAGGCGATCTTTAAGGAGACGTTCAGAaaCAGAGCCAGCCACTGATAGCCAAGATAAAGAAAATAATCAtaAAAGGGAGAGACGAA
AGGAAGAAGAAAAGACTCTGCAGAAG--------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
-------------------------------------------------------------------GTTCGCCGTGTCTCCTTTGCAGATCCAATATAC
CAAGCAGGATTGGCAGATGACATTGATAGGCGATGCTCTATTATAAGGTGCCATTCTTCAAATAGTTCTTCCATGGTAAAAAGTGCTAAAACTTCACCCA
CTGCACATTCTAAGCATAATACCACTTCAACCAAAGGATTTCTGTCCCCAGGATCACGTAGCCCTAAATTTAAGAGCTCAAAGAAGTGTTTAATTGCAGA
AATGGCTAAGGAATCTGTGCCATGCCCCACAGAAAGTGTTTACCCTGCCTTGGTGAACTGTGCAGCACCGGTTGACATCATTTTACCGCAGATTACGTCC
AACATG---GCAAGAGGACTGGGACAACTCATTAGAGCCAAGAATATAAAAACAATTGGTGATTTGAGTACTCTTACAGCATCTGAAATAAAAACTCTCC
CTATCCGTTCTCCAAAAGTGTCTAATGTAAAAAAGGCACTCAGAGTATATCATGAGCAGCAGGTGAAGTCTCGTGGACTAGAAGAGATTCCAGTTTTTGA
TATTTCTGAAAAAACAATAAATGGAATGGAAAATAAATCTGTTTCTCCTGATGAAGAAAGACTTGCCTCA---TTAATTGATCCTGTTGCTTTAGAAACT
CCATTATCTAAAAACCTTGTGGCACAGATTAGTGCACTCGCTCTTCAGCTGGATTCAGAAGATCTCCATAATTATTCAGGAAGTCAGTTATTCGAAATGC
ATGAGAAACTTGGTAGCATGGCAAACTGTATAATTAAAAATCTTCAGTCACGTTGGAGGTCACCAGCCCATGAAAATTCTATTTAG


>BGISUSP0000899841
---------------------------------------------IIEIEKKLPRLFKVLK-HITSQNSELSSAALQALGFCLYNPKITSALS-----EL
LSKLNDTIKSSDKNVRTRALWVISKQTFPPEVLGK---------------------------------LIEQAPIQMGEESITWAKVVIP----------
-------------------------------KLLSELQKLFMSKNETYVLKLWPLFVKLLGK--------------------------------------
---------ILCSAKRLKLLMQPLSSIHVRTEALALTKLEVWWYLL-------------VCVPLIQSTISIDSNASPQGSSSRVATSPGLNPMTPVHK--
----------------------------------------------------------PLEHPLISSSSFFSKHANTLITAVHDSFVAVGKD--------
----------------NRKERPGSEVLTLLLKCLESIVKSEVFPVSKMLVLMEITIKGLPQKVLGSPAYQVANMDILNGTPALFLIQLIFNNNLECGVED
E-FFLSLETLVGSVLSGPTSPLAFSDSVLNVINQNAKQLENKEHLWRMWSIIVT--------TNEVNQGDALEHNFSAIYGALTLPINHIFSAQKIPV--
----------------------------------------------------------------------------------PQRPSDWSKKKKEPLGKL
ASLFKLIVRVIYSFHTLSLKEVHCDTLLIIGNSIISILSNVLGHISLPSMIRKIFATLTKPLVLFYENS----------------EKLLGEIACLHISYT
VTYDRILEQISPLLCVIFSHKNKQIRKQSAQFWNATFAKVAMLIYPEEL-PVLQAKQKSLLLGLEVEIMEESSGPYSD----------------------
----------------------------------------------------------------------CDIPAMYNNLDVSQDTLFSQYSQEE-----
----------------------------------------------------------------------------------------------------
----------------------GSENRPFSPSPLNDMSSTVTVKNSQEGTTKTDNPSKAKKVVLLQSDSEKIVHGIKRSGRKSSRSEPTGNKKSKPLMRS
DQEKSTRESFDGMVALENNPPGLLNETECVLDHQVHLSESAVEYGDTTLKPTVENAVLLESSTVEDKSLEINLESKENTPPAITTADHTVNEDSHVQVTS
NQKTLRRSLRRRSETEPATDSQDKENNHKRERRKEEEKTLQK----------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
-----------------------------------------------------------------------------------------VRRVSFADPIY
QAGLADDIDRRCSIIRCHSSNSSSMVKSAKTSPTAHSKHNTTSTKGFLSPGSRSPKFKSSKKCLIAEMAKESVPCPTESVYPALVNCAAPVDIILPQITS
NM-ARGLGQLIRAKNIKTIGDLSTLTASEIKTLPIRSPKVSNVKKALRVYHEQQVKSRGLEEIPVFDISEKTINGMENKSVSPDEERLAS-LIDPVALET
PLSKNLVAQISALALQLDSEDLHNYSGSQLFEMHEKLGSMANCIIKNLQSRWRSPAHENSI*