Sequences
EST Library Info
csp2Spleen - RNA from China
cst5Stomach - RNA from China
nca1Newborn 115 days, cartillage
Clusters
Oligos
SNPs

Gene ID ENSG00000145916 (click for geneview)
Transcript ID ENST00000360637(link to ensembl)
Symbol Q8N9Q5_HUMAN
Localtion Chromosome:5:177490634:177508084:1 band: 5q35.3
Description Hypothetical protein FLJ36746.
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--E--Q--C--A--C--V--E--R--E--L--D--K--V--L--Q--K--F--L--T--Y--G--Q--H--C--E--R--S--L--E--E--L--L--
ATGGAGCAGTGTGCGTGCGTGGAGAGAGAGCTGGACAAGGTCCTGCAGAAGTTCCTGACCTACGGGCAGCACTGTGAGCGGAGCCTGGAGGAGCTGCTGC
::::::::::::::: :::::::::::::: ::::::::::::::::::::::::::::::::::::::::::::::::.:::..::::::::.::.:::
ATGGAGCAGTGTGCGAGCGTGGAGAGAGAGGTGGACAAGGTCCTGCAGAAGTTCCTGACCTACGGGCAGCACTGTGAGCAGAGTTTGGAGGAGTTGTTGC
-M--E--Q--C--A--S--V--E--R--E--V--D--K--V--L--Q--K--F--L--T--Y--G--Q--H--C--E--Q--S--L--E--E--L--L--

--------------------------------------><------------------------------------------------------------
H--Y--V--G--Q--L--R--A--E--L--A--S--A--A--L--Q--G--T--P--L--S--A--T--L--S--L--V--M--S--Q--C--C--R--K
ACTACGTGGGCCAGCTGCGGGCTGAGCTGGCCAGCGCAGCCCTCCAGGGGACCCCTCTCTCAGCCACCCTCTCTCTGGTGATGTCACAGTGCTGCCGGAA
.::::::::::::::::::::::::::::::::::      :::::::::::::::::::: :::::::::::.::::::::::: ::::::::::::::
GCTACGTGGGCCAGCTGCGGGCTGAGCTGGCCAGC------CTCCAGGGGACCCCTCTCTCTGCCACCCTCTCCCTGGTGATGTCCCAGTGCTGCCGGAA
R--Y--V--G--Q--L--R--A--E--L--A--S--------L--Q--G--T--P--L--S--A--T--L--S--L--V--M--S--Q--C--C--R--K

----------------------------------------------------------------------------------------------------
--I--K--D--T--V--Q--K--L--A--S--D--H--K--D--I--H--S--S--V--S--R--V--G--K--A--I--D--R--V--S--T--W--P-
GATCAAAGATACGGTGCAGAAACTGGCTTCGGACCATAAGGACATTCACAGCAGTGTATCCCGAGTGGGCAAAGCCATTGACAGGGTGAGCACGTGGCCG
::: :::::.:: ::::: :::::::::::::::::.:::::::::::::::::::: ::::::::::: ::::::::::::::::::::::.:::: ::
GATAAAAGACACTGTGCATAAACTGGCTTCGGACCACAAGGACATTCACAGCAGTGTCTCCCGAGTGGGGAAAGCCATTGACAGGGTGAGCATGTGGGCG
--I--K--D--T--V--H--K--L--A--S--D--H--K--D--I--H--S--S--V--S--R--V--G--K--A--I--D--R--V--S--M--W--A-

----------------------------------------------------------------------------------------------------
-A--P--G--V--G--W--E--H-----P--E--A--G--M--Y--K--D--S--K--E--S--Q--Q--E-----C-----P--H-----H--Q--A--
GCTCCAGGCGTGGGGTGGGAGCAC---CCTGAAGCTGGGATGTACAAGGACTCGAAGGAGAGCCAGCAAGAG---TGC---CCGCAT---CACCAGGCCC
::.:..:.: ::::: :: .  .    :::. .:::.: ::: :  :::.:::   .:..::::::.. :::   :::   ::  :    ::. .:: ::
GCCCTGGACCTGGGGAGGCGTGGGACCCCTATGGCTAGTATGGAGCAGGGCTCCTCAGGAAGCCAGTGTGAGAAGTGCGAGCCTGAGT--CATAGGGACC
-A--L--D--L--G--R--R--G--T--P--M--A--S--M--E--Q--G--S--S--G--S--Q--C--E--K--C--E--P--E--\--H--R--D--

----------------------------------------------------------------------------------------------------
L--S--L--L--L--R--Q--N--F--D--S--E--I--C--G--V--V--S--D--A--V--W--D--A--R--E--Q--Q--Q--Q--I--L--Q--M
TGTCTCTCCTCCTTCGTCAGAACTTCGACTCTGAGATCTGTGGTGTTGTGTCAGATGCGGTGTGGGACGCGCGGGAACAGCAGCAGCAGATCCTGCAGAT
:::::::: :::: :.:::::::::.:::::::::::.::.::::: :: :: ::::: :: :::::: : :::::. ::::::::::::::::::::::
TGTCTCTCATCCT-CATCAGAACTTTGACTCTGAGATTTGCGGTGTAGTCTCCGATGCTGTTTGGGACTCTCGGGAGAAGCAGCAGCAGATCCTGCAGAT
L--S--L--I--L--H--Q--N--F--D--S--E--I--C--G--V--V--S--D--A--V--W--D--S--R--E--K--Q--Q--Q--I--L--Q--M

---------------------------------------------------------------><-----------------------------------
--A--I--V--E--H--L--Y--Q--Q--G--M--L--S--V--A--E--E--L--C--Q--E--S--T--L--N--V--D--L--D--F--K--Q--P-
GGCCATCGTGGAACACCTGTATCAGCAGGGCATGCTCAGCGTGGCCGAGGAGCTGTGCCAGGAATCAACGCTGAATGTGGACTTGGATTTCAAGCAGCCT
::::::.:::::.::::::::.:::::::::::::::::.:::::.:::::.:::::::::::::::::..:::::::::::.:::::::::::::::::
GGCCATTGTGGAGCACCTGTACCAGCAGGGCATGCTCAGTGTGGCTGAGGAACTGTGCCAGGAATCAACATTGAATGTGGACCTGGATTTCAAGCAGCCT
--A--I--V--E--H--L--Y--Q--Q--G--M--L--S--V--A--E--E--L--C--Q--E--S--T--L--N--V--D--L--D--F--K--Q--P-

----------------------------------------------------------------><----------------------------------
-F--L--E--L--N--R--I--L--E--A--L--H--E--Q--D--L--G--P--A--L--E--W--A--V--S--H--R--Q--R--L--L--E--L--
TTCCTAGAGTTGAATCGAATCCTGGAAGCCCTGCACGAACAAGACCTGGGTCCTGCGTTGGAATGGGCCGTCTCCCACAGGCAGCGCCTGCTGGAACTCA
:::.:.:::::::::::::::::::::::.:::::::::::::::.:::: :: ::..::   :::::.:::::::::::::::::  :::: ::.::::
TTCTTGGAGTTGAATCGAATCCTGGAAGCTCTGCACGAACAAGACTTGGGGCCAGCACTG---TGGGCTGTCTCCCACAGGCAGCGAGTGCTCGAGCTCA
-F--L--E--L--N--R--I--L--E--A--L--H--E--Q--D--L--G--P--A--L-----W--A--V--S--H--R--Q--R--V--L--E--L--

----------------------------------------------------------------------------------------------------
N--S--S--L--E--F--K--L--H--R--L--H--F--I--R--L--L--A--G--G--P--A--K--Q--L--E--A--L--S--Y--A--R--H--F
ACAGCTCCCTGGAGTTCAAGCTGCACCGACTGCACTTCATCCGCCTCTTGGCAGGAGGCCCCGCGAAGCAGCTGGAGGCCCTCAGCTATGCTCGGCACTT
::::::::::::::::::::.:.:::::: ::::::::::.::::::.::::::: ::::::: ::::::::::::::::::::::::.::.::::::::
ACAGCTCCCTGGAGTTCAAGTTACACCGAATGCACTTCATTCGCCTCCTGGCAGGCGGCCCCGAGAAGCAGCTGGAGGCCCTCAGCTACGCCCGGCACTT
N--S--S--L--E--F--K--L--H--R--M--H--F--I--R--L--L--A--G--G--P--E--K--Q--L--E--A--L--S--Y--A--R--H--F

-------------------------------><-------------------------------------------------------------------
--Q--P--F--A--R--L--H--Q--R--E--I--Q--V--M--M--G--S--L--V--Y--L--R--L--G-----L--E--K--S--P--Y--C--H-
CCAGCCCTTTGCTCGGCTGCACCAGCGGGAGATCCAGGTGATGATGGGCAGCCTGGTGTACCTGCGGCTGGGC---TTGGAGAAGTCACCCTACTGCCAC
::::::::::::::::::::::::::::   :: :::::::::::::::::.:::::::::::::::::.:::   :::::::::::.::::::::::::
CCAGCCCTTTGCTCGGCTGCACCAGCGG---ATACAGGTGATGATGGGCAGTCTGGTGTACCTGCGGCTAGGCT--TTGGAGAAGTCGCCCTACTGCCAC
--Q--P--F--A--R--L--H--Q--R-----I--Q--V--M--M--G--S--L--V--Y--L--R--L--G--\--L--E--K--S--P--Y--C--H-

----------------------------------------------------------------------------------------------------
-L--L--D--S--S--H--W--A--E--I--C--E--T--F--T--R--D--A--C--S--L--L--G--L--S--V--E--S--P--L--S--V--S--
CTGCTGGACAGCAGCCACTGGGCAGAGATCTGTGAGACCTTTACCCGGGACGCCTGTTCCCTGCTGGGGCTTTCTGTGGAGTCCCCCCTTAGCGTCAGCT
:: :::::::.::::::.::::: :::::::::::::::::.:::::.::.::.::::::::::::::::::::::::::::: :::::.::::::   :
CTCCTGGACAACAGCCATTGGGCCGAGATCTGTGAGACCTTCACCCGAGATGCTTGTTCCCTGCTGGGGCTTTCTGTGGAGTCACCCCTCAGCGTC---T
-L--L--D--N--S--H--W--A--E--I--C--E--T--F--T--R--D--A--C--S--L--L--G--L--S--V--E--S--P--L--S--V-----

><--------------------------------------------------------------------------------------------------
F--A--S--G--C--V--A--L--P--V--L--M--N--I--K--A--V--I--E--Q--R--Q--C--T--G--V--W--N--H--K--D--E--L--P
TTGCCTCTGGCTGTGTGGCGCTGCCTGTGTTGATGAACATCAAGGCTGTGATTGAGCAGCGGCAGTGCACTGGGGTCTGGAATCACAAGGACGAGTTACC
::::.:::::::::::.::.:::::.:::.:::::::::::::.:::::::::::.::: :::::::::::::::::::::.:::::::::.::::::::
TTGCTTCTGGCTGTGTAGCACTGCCCGTGCTGATGAACATCAAAGCTGTGATTGAACAGAGGCAGTGCACTGGGGTCTGGAGTCACAAGGATGAGTTACC
F--A--S--G--C--V--A--L--P--V--L--M--N--I--K--A--V--I--E--Q--R--Q--C--T--G--V--W--S--H--K--D--E--L--P

---><-----------------------------------------------------------------------------------------------
--I--E--I--E--L--G--M--K--C--W--Y--H--S--V--F--A--C--P--I--L--R--Q--Q--T--S--D--S--N--P--P--I--K--L-
GATTGAGATTGAACTAGGCATGAAGTGCTGGTACCACTCCGTGTTCGCTTGCCCCATCCTCCGCCAGCAGACGTCAGATTCCAACCCTCCCATCAAGCTC
:::::::::.:::::.:: :::::::::::::::::::: :::::.:: :::::::::::::::::::::::.::.::::::::::::::::::::::::
GATTGAGATCGAACTGGGAATGAAGTGCTGGTACCACTCAGTGTTTGCGTGCCCCATCCTCCGCCAGCAGACATCGGATTCCAACCCTCCCATCAAGCTC
--I--E--I--E--L--G--M--K--C--W--Y--H--S--V--F--A--C--P--I--L--R--Q--Q--T--S--D--S--N--P--P--I--K--L-

----------------------------------------------------------><----------------------------------------
-I--C--G--H--V--I--S--R--D--A--L--N--K--L--I--N--G--G--K--L--K--C--P--Y--C--P--M--E--Q--N--P--A--D--
ATCTGTGGCCATGTTATCTCCCGAGATGCACTCAATAAGCTCATTAATGGAGGAAAGCTGAAGTGTCCCTACTGTCCCATGGAGCAGAACCCGGCAGATG
:::::.::::::::.:::::  :::::::::::::.::.::::::::.::::::   ::::::::.:::::: :::::::::::::::::::.:::::::
ATCTGCGGCCATGTCATCTCGAGAGATGCACTCAACAAACTCATTAACGGAGGA---CTGAAGTGCCCCTACGGTCCCATGGAGCAGAACCCAGCAGATG
-I--C--G--H--V--I--S--R--D--A--L--N--K--L--I--N--G--G-----L--K--C--P--Y--G--P--M--E--Q--N--P--A--D--

--------------------
G--K--R--I--I--F--*-
GGAAACGCATCATATTCTGA
::::.:::::::::::::::
GGAAGCGCATCATATTCTGA
G--K--R--I--I--F--*-

Pig Consensus Sequence

>BGISUST0000880602
ATGGAGCAGTGTGCGAGCGTGGAGAGAGAGGTGGACAAGGTCCTGCAGAAGTTCCTGACCTACGGGCAGCACTGTGAGCAGAGTTTGGAGGAGTTGTTGC
GCTACGTGGGCCAGCTGCGGGCTGAGCTGGCCAGC------CTCCAGGGGACCCCTCTCTCTGCCACCCTCTCCCTGGTGATGTCCCAGTGCTGCCGGAA
GATAAAAGACACTGTGCATAAACTGGCTTCGGACCACAAGGACATTCACAGCAGTGTCTCCCGAGTGGGGAAAGCCATTGACAGGGTGAGCATGTGGGCG
GCCCTGGACCTGGGGAGGCGTGGGACCCCTATGGCTAGTATGGAGCAGGGCTCCTCAGGAAGCCAGTGTGAGAAGTGcaGCCTGAGTCATAGGGACCTgt
CTCATCCTCATCAGAACTTTGACTCTGAGATTTGCGGTGTAGTCTCCGATGCTGTTTGGGACTCTCGGGAGAAGCAGCAGCAGATCCTGCAGATGGCCAT
TGTGGAGCACCTGTACCAGCAGGGCATGCTCAGTGTGGCTGAGGAAGAATCAACATTGAATGTGGACCTGGATTTCAAGCAGCCTTTCTTGGAGTTGAAT
CGAATCCTGGAAGCTCTGCACGAACAAGACTTGGGGCCAGCACTG---TGGGCTGTCTCCCACAGGCAGCGAGTGCTCGAGCTCAACAGCTCCCTGGAGT
TCAAGTTACACCGAATGCACTTCATTCGCCTCCTGGCAGGCGGCCCCGAGAAGCAGCTGGAGGCCCTCAGCTACGCCCGGCACTTCCAGCCCTTTGCTCG
GCTGCACCAGCGG---ATACAGGTGATGATGGGCAGTCTGGTGTACCTGCGGCTAGGctTGGAGAAGTCGCCCTACTGCCACCTCCTGGACAACAGCCAT
TGGGCCGAGATCTGTGAGACCTTCACCCGAGATGCTTGTTCCCTGCTGGGGCTTTCTGTGGAGTCACCCCTCAGCGTC---TTTGCTTCTGGCTGTGTAG
CACTGCCCGTGCTGATGAACATCAAAGCTGTGATTGAACAGAGGCAGTGCACTGGGGTCTGGAGTCACAAGGATGAGTTACCGATTGAGATCGAACTGGG
AATGAAGTGCTGGTACCACTCAGTGTTTGCGTGCCCCATCCTCCGCCAGCAGACATCGGATTCCAACCCTCCCATCAAGCTCATCTGCGGCCATGTCATC
TCGAGAGATGCACTCAACAAACTCATTAACGGAGGA---CTGAAGTGCCCCTACGGTCCCATGGAGCAGAACCCAGCAGATGGGAAGCGCATCATATTCT
GA


>BGISUSP0000880602
MEQCASVEREVDKVLQKFLTYGQHCEQSLEELLRYVGQLRAELAS--LQGTPLSATLSLVMSQCCRKIKDTVHKLASDHKDIHSSVSRVGKAIDRVSMWA
ALDLGRRGTPMASMEQGSSGSQCEKCSLSHRDLSHPHQNFDSEICGVVSDAVWDSREKQQQILQMAIVEHLYQQGMLSVAEEESTLNVDLDFKQPFLELN
RILEALHEQDLGPAL-WAVSHRQRVLELNSSLEFKLHRMHFIRLLAGGPEKQLEALSYARHFQPFARLHQR-IQVMMGSLVYLRLGLEKSPYCHLLDNSH
WAEICETFTRDACSLLGLSVESPLSV-FASGCVALPVLMNIKAVIEQRQCTGVWSHKDELPIEIELGMKCWYHSVFACPILRQQTSDSNPPIKLICGHVI
SRDALNKLINGG-LKCPYGPMEQNPADGKRIIF*