Sequences
EST Library Info
che1Heart - RNA from China
eru2Foetus 50 days, regio umbilicalis
hlv1Heart, left ventricle
jca1Joint capsule
nms1Newborn 115 days, M. semitendinosus
pldo1Unavailable
sme2M. Semimembranosus
ssp1M. Supraspinatus
vin1M. Vastus intermedius
Clusters
Oligos
SNPs

Gene ID ENSG00000198842 (click for geneview)
Transcript ID ENST00000361200(link to ensembl)
Symbol Q9C074_HUMAN
Localtion Chromosome:1:163827431:163830024:1 band: 1q24.1
Description PREDICTED: hypothetical cardiac/skeletal muscle-expressed ORF
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--S--S--E--S--T--W--D--A--W--N--E--R--L--L--E--I--E--K--E--A--S--R--R--Y--H--A--K--S--K--R--E--E--
ATGTCCTCGGAGAGCACCTGGGACGCATGGAACGAGAGGCTGCTGGAGATTGAGAAGGAGGCTTCCCGGAGGTACCACGCCAAGAGCAAGAGAGAGGAGG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
A--A--D--R--S--S--E--A--G--S--R--V--R--E--D--D--E--D--S--V--G--S--E--A--S--S--F--Y--N--F--C--S--R--N
CGGCAGACAGGAGCTCAGAAGCAGGGAGCAGGGTGCGGGAGGATGATGAGGACAGCGTGGGCTCTGAGGCCAGTTCCTTCTACAACTTCTGCAGCAGGAA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--K--D--K--L--T--A--L--E--R--W--K--I--K--R--I--Q--F--G--F--H--K--K--D--L--G--A--G--D--S--S--G--E--P-
CAAGGACAAGCTCACTGCCCTGGAAAGATGGAAGATCAAGAGAATCCAATTTGGATTTCACAAGAAAGACTTGGGAGCGGGAGACAGCAGCGGTGAGCCC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-G--A--E--E--A--V--G--E--K--N--P--S--D--V--S--L--T--A--Y--Q--A--W--K--L--K--H--Q--K--K--V--G--S--E--
GGTGCAGAGGAGGCAGTAGGGGAGAAGAACCCCTCCGACGTCAGCCTGACAGCCTACCAGGCCTGGAAGCTGAAACACCAGAAGAAGGTGGGCAGTGAGA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
N--K--E--E--V--V--E--L--S--K--G--E--D--S--A--L--A--K--K--R--Q--R--R--L--E--L--L--E--R--S--R--Q--T--L
ACAAGGAGGAGGTGGTGGAGCTCAGCAAGGGGGAGGACTCGGCCTTGGCTAAGAAGAGACAACGGAGGCTGGAGCTGCTGGAGAGAAGCCGGCAGACGCT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--E--E--S--Q--S--M--A--S--W--E--A--D--S--S--T--A--S--G--S--I--P--L--S--A--F--W--S--A--D--P--S--V--S-
GGAGGAGAGCCAGTCTATGGCAAGCTGGGAGGCGGACAGCTCCACGGCCAGCGGGAGCATTCCCCTGTCTGCGTTCTGGTCTGCAGACCCCTCAGTCAGC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-A--D--G--D--T--T--S--V--L--S--T--Q--S--H--R--S--H--L--S--Q--A--A--S--N--I--A--G--C--S--T--S--N--P--
GCTGATGGGGACACGACGTCAGTACTGAGCACCCAGAGCCACCGCTCCCACCTGTCTCAGGCTGCAAGCAACATAGCGGGGTGTTCAACCTCCAACCCCA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
T--T--P--L--P--N--L--P--V--G--P--G--D--T--I--S--I--A--S--I--Q--N--W--I--A--N--V--V--S--E--T--L--A--Q
CCACACCCCTGCCTAACCTGCCAGTGGGGCCTGGAGACACCATTTCCATTGCCAGTATCCAGAACTGGATTGCCAATGTAGTCAGTGAGACCCTTGCTCA
                                                              ::::::::::::::::::::::::::.:: :: ::.::
--------------------------------------------------------------AACTGGATTGCCAATGTAGTCAGTGAAACGCTGGCCCA
---------------------------------------------------------------N--W--I--A--N--V--V--S--E--T--L--A--Q

----------------------------------------------------------------------------------------------------
--K--Q--N--E--M--L--L--L--S--R--S--P--S--V--A--S--M--K--A--V--P--A--A--S--C--L--G--D--D--Q--V--S--M-
GAAGCAAAATGAAATGCTGCTGTTGTCCCGCTCACCGTCTGTTGCAAGCATGAAGGCAGTACCAGCGGCTAGCTGCCTGGGGGATGACCAAGTCTCCATG
:::.:::::::::::.::::: ::::::::::::::.:::::::::::::::::::..:.:::::: ::.:::::.::::::::::::::::::::::::
GAAACAAAATGAAATACTGCTCTTGTCCCGCTCACCATCTGTTGCAAGCATGAAGGTGGCACCAGCCGCCAGCTGTCTGGGGGATGACCAAGTCTCCATG
--K--Q--N--E--I--L--L--L--S--R--S--P--S--V--A--S--M--K--V--A--P--A--A--S--C--L--G--D--D--Q--V--S--M-

----------------------------------------------------------------------------------------------------
-L--S--G--H--S--S--S--S--L--G--G--C--L--L--P--Q--S--Q--A--R--P--S--S--D--M--Q--S--V--L--S--C--N--T--
CTTAGTGGACACAGCAGCTCCTCCTTGGGTGGCTGCCTGTTGCCTCAGAGCCAGGCAAGACCCAGCTCTGACATGCAGTCTGTGCTGTCCTGCAACACCA
::::::::::: ::::::::::::.::::::: : ::::.:::::::.::.::::::::::::::::::::::..:::::::: ::::::: : :.::::
CTTAGTGGACAGAGCAGCTCCTCCCTGGGTGGATCCCTGCTGCCTCAAAGTCAGGCAAGACCCAGCTCTGACACACAGTCTGTTCTGTCCTCCCATACCA
-L--S--G--Q--S--S--S--S--L--G--G--S--L--L--P--Q--S--Q--A--R--P--S--S--D--T--Q--S--V--L--S--S--H--T--

----------------------------------------------------------------------------------------------------
T--L--S--S--P--A--E--S--C--R--S--K--V--R--G--T--S--K--P--I--F--S--L--F--A--D--N--V--D--L--K--E--L--G
CACTGAGCTCACCCGCGGAAAGTTGCAGAAGCAAAGTGAGGGGGACCAGCAAGCCCATCTTCAGCCTCTTTGCTGACAATGTGGACCTAAAGGAACTTGG
::: ::::::.   :: :::.::  ..:.::::::::::::::::::::::::::.:::: .:::::::::::::::::::: :::::::.:::.:::::
CACAGAGCTCGAGGGCCGAAGGTACTGGGAGCAAAGTGAGGGGGACCAGCAAGCCTATCTATAGCCTCTTTGCTGACAATGTCGACCTAAGGGAGCTTGG
T--Q--S--S--R--A--E--G--T--G--S--K--V--R--G--T--S--K--P--I--Y--S--L--F--A--D--N--V--D--L--R--E--L--G

----------------------------------------------------------------------------------------------------
--R--K--E--K--E--M--Q--M--E--L--R--E--K--M--S--E--Y--K--M--E--K--L--A--S--D--N--K--R--S--S--L--F--K-
CCGGAAGGAGAAGGAGATGCAGATGGAGCTTAGGGAGAAGATGTCTGAGTACAAAATGGAAAAGCTGGCCTCAGACAACAAACGCAGCTCCCTCTTCAAG
::::::::::::.::::::::.::::::::.:.:::::::::::::::::::::::::::.::::::::::: ::::::::::::::::::::.::::::
CCGGAAGGAGAAAGAGATGCAAATGGAGCTCAAGGAGAAGATGTCTGAGTACAAAATGGAGAAGCTGGCCTCCGACAACAAACGCAGCTCCCTTTTCAAG
--R--K--E--K--E--M--Q--M--E--L--K--E--K--M--S--E--Y--K--M--E--K--L--A--S--D--N--K--R--S--S--L--F--K-

----------------------------------------------------------------------------------------------------
-K--K--K--V--K--E--D--E--D--D--G--V--G--D--G--D--E--D--T--D--S--A--I--G--S--F--R--Y--S--S--R--S--N--
AAGAAGAAGGTCAAGGAAGATGAGGATGATGGTGTGGGTGATGGGGATGAGGACACTGACAGTGCCATAGGGAGCTTCCGATATTCTTCCCGCAGTAATT
:::::::::: ::.::.::::::.:::::::..::::::::. ::::::::::::::::::::::::::::::::::::: :::::::::::::::::::
AAGAAGAAGGGCAGGGGAGATGAAGATGATGACGTGGGTGACTGGGATGAGGACACTGACAGTGCCATAGGGAGCTTCCGCTATTCTTCCCGCAGTAATT
-K--K--K--G--R--G--D--E--D--D--D--V--G--D--W--D--E--D--T--D--S--A--I--G--S--F--R--Y--S--S--R--S--N--

----------------------------------------------------------------------------------------------------
S--Q--K--P--E--T--D--T--C--S--S--L--A--V--C--D--H--Y--A--S--G--S--R--V--G--K--E--M--D--S--S--I--N--K
CCCAGAAACCTGAAACAGACACATGCTCCTCCCTGGCTGTCTGTGATCACTATGCAAGTGGCAGCAGAGTTGGCAAAGAGATGGATAGCAGTATTAATAA
:.::::::::.:::::::::::   :::::::::::::::.: :::: .::::: ::::::::::::::.::::::::::::::::::::::::::::::
CTCAGAAACCCGAAACAGACACCGCCTCCTCCCTGGCTGTTTCTGATAGCTATGGAAGTGGCAGCAGAGCTGGCAAAGAGATGGATAGCAGTATTAATAA
S--Q--K--P--E--T--D--T--A--S--S--L--A--V--S--D--S--Y--G--S--G--S--R--A--G--K--E--M--D--S--S--I--N--K

----------------------------------------------------------------------------------------------------
--W--L--S--G--L--R--T--E--E--K--P--P--F--Q--S--D--W--S--G--S--S--R--G--K--Y--T--R--S--S--L--L--R--E-
GTGGCTCAGTGGCCTCAGGACGGAGGAAAAACCTCCTTTCCAAAGTGACTGGTCTGGAAGTTCCAGAGGGAAGTACACCAGATCGTCCCTGCTCAGGGAG
:::::::::::::::::::::.:::::::::.:::::..:::::::::.:::::::::::.:::::.:::::::.::::::::: ::::::::: :::::
GTGGCTCAGTGGCCTCAGGACAGAGGAAAAATCTCCTCCCCAAAGTGATTGGTCTGGAAGCTCCAGGGGGAAGTGCACCAGATCTTCCCTGCTCCGGGAG
--W--L--S--G--L--R--T--E--E--K--S--P--P--Q--S--D--W--S--G--S--S--R--G--K--C--T--R--S--S--L--L--R--E-

----------------------------------------------------------------------------------------------------
-T--E--S--K--S--S--S--Y--K--F--S--K--S--Q--S--E--E--Q--D--T--S--S--Y--H--E--A--N--G--N--S--V--R--S--
ACAGAGTCTAAATCCTCCAGTTACAAGTTTTCCAAATCCCAGTCAGAGGAACAGGACACCTCCTCCTACCACGAGGCAAATGGCAACTCTGTAAGAAGCA
:::::::::::.:::::::::::.:::::.::::::::::::::::::::::::::::::::::::::::::::::: ::::::::::::::::::::::
ACAGAGTCTAAGTCCTCCAGTTATAAGTTCTCCAAATCCCAGTCAGAGGAACAGGACACCTCCTCCTACCACGAGGCCAATGGCAACTCTGTAAGAAGCA
-T--E--S--K--S--S--S--Y--K--F--S--K--S--Q--S--E--E--Q--D--T--S--S--Y--H--E--A--N--G--N--S--V--R--S--

----------------------------------------------------------------------------------------------------
T--S--R--F--S--S--S--S--T--R--E--G--R--E--M--H--K--F--S--R--S--T--Y--N--E--T--S--S--S--R--E--E--S--P
CTTCACGGTTCTCATCTTCCTCCACCAGGGAGGGCAGAGAGATGCACAAGTTCTCCAGGTCCACGTACAACGAGACCTCAAGTTCCCGAGAGGAGAGCCC
::::. .::::::  ::::::::::::::::::::::::::::::::: :::::::::::: ::.: ::..::::::::::::::.::::::::.:::::
CTTCGAAGTTCTCTGCTTCCTCCACCAGGGAGGGCAGAGAGATGCACACGTTCTCCAGGTCGACATTCAGTGAGACCTCAAGTTCTCGAGAGGAAAGCCC
T--S--K--F--S--A--S--S--T--R--E--G--R--E--M--H--T--F--S--R--S--T--F--S--E--T--S--S--S--R--E--E--S--P

----------------------------------------------------------------------------------------------------
--E--P--Y--F--F--R--R--T--P--E--S--S--E--R--E--E--S--P--E--P--Q--R--P--N--W--A--R--S--R--D--W--E--D-
AGAGCCCTACTTCTTCCGCCGGACCCCAGAGTCCTCAGAAAGGGAAGAGTCCCCAGAACCACAGCGCCCAAATTGGGCCAGGTCCAGGGACTGGGAAGAT
::::::::::::::::::.:::::::: :::.:::: :::.:::::::::::::::::::::.:::.::.:::::::::::..:::::::::::::::::
AGAGCCCTACTTCTTCCGTCGGACCCCTGAGCCCTCTGAAGGGGAAGAGTCCCCAGAACCACGGCGTCCGAATTGGGCCAGACCCAGGGACTGGGAAGAT
--E--P--Y--F--F--R--R--T--P--E--P--S--E--G--E--E--S--P--E--P--R--R--P--N--W--A--R--P--R--D--W--E--D-

----------------------------------------------------------------------------------------------------
-V--E--E--S--S--K--S--D--F--S--E--F--G--A--K--R--K--F--T--Q--S--F--M--R--S--E--E--E--G--E--K--E--R--
GTGGAAGAGTCATCCAAGTCAGACTTCTCTGAATTTGGAGCCAAGAGGAAGTTCACCCAGAGCTTTATGAGGTCTGAAGAAGAGGGAGAGAAAGAGAGGA
::::::::::::::::::::.:::::.:::::::::::::::::::::::.::::::::::::::.::::::::::::::.:::::.:::::::::::::
GTGGAAGAGTCATCCAAGTCGGACTTTTCTGAATTTGGAGCCAAGAGGAAATTCACCCAGAGCTTCATGAGGTCTGAAGAGGAGGGGGAGAAAGAGAGGA
-V--E--E--S--S--K--S--D--F--S--E--F--G--A--K--R--K--F--T--Q--S--F--M--R--S--E--E--E--G--E--K--E--R--

----------------------------------------------------------------------------------------------------
T--E--N--R--E--E--G--R--F--A--S--G--R--R--S--Q--Y--R--R--S--T--D--R--E--E--E--E--E--M--D--D--E--A--I
CAGAAAACAGAGAAGAAGGGAGGTTTGCATCTGGACGGCGGTCCCAGTATCGGAGAAGCACTGACAGGGAGGAAGAGGAAGAAATGGACGATGAAGCCAT
..::::: ::::::::.::::::::::: :: ::: :::::::::::::::::::::::::::::::::::::.:::::.::::::::::::::::::::
TGGAAAAGAGAGAAGAGGGGAGGTTTGCTTCAGGAAGGCGGTCCCAGTATCGGAGAAGCACTGACAGGGAGGAGGAGGAGGAAATGGACGATGAAGCCAT
M--E--K--R--E--E--G--R--F--A--S--G--R--R--S--Q--Y--R--R--S--T--D--R--E--E--E--E--E--M--D--D--E--A--I

------------------------------------------------------------------>
--I--A--A--W--R--R--R--Q--E--E--T--R--T--K--L--Q--K--R--R--E--D--*-
CATTGCTGCTTGGAGACGCCGGCAAGAAGAAACCAGGACCAAGCTGCAGAAAAGGAGGGAGGACTGA
:::::::::.:::::::::::::::::::::::::::::.::::::::::..::::::::.::.:.:
CATTGCTGCCTGGAGACGCCGGCAAGAAGAAACCAGGACTAAGCTGCAGAGGAGGAGGGAAGATTAA
--I--A--A--W--R--R--R--Q--E--E--T--R--T--K--L--Q--R--R--R--E--D--*-

Pig Consensus Sequence

>BGISUST0000888436
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
--------------------------------------------------------------AACTGGATTGCCAATGTAGTCAGTGAAACGCTGGCCCA
GAAACAAAATGAAATACTGCTCTTGTCCCGCTCACCATCTGTTGCAAGCATGAAGGTGGCACCAGCCGCCAGCTGTCTGGGGGATGACCAAGTCTCCATG
CTTAGTGGACAGAGCAGCTCCTCCCTGGGTGGATCCCTGCTGCCTCAAAGTCAGGCAAGACCCAGCTCTGACACACAGTCTGTTCTGTCCTCCCATACCA
CACAGAGCTCGAGGGCCGAAGGTACTGGGAGCAAAGTGAGGGGGACCAGCAAGCCTATCTATAGCCTCTTTGCTGACAATGTCGACCTAAGGGAGCTTGG
CCGGAAGGAGAAAGAGATGCAAATGGAGCTCAAGGAGAAGATGTCTGAGTACAAAATGGAGAAGCTGGCCTCCGACAACAAACGCAGCTCCCTTTTCAAG
AAGAAGAAGGGCAGGGGAGATGAAGATGATGACGTGGGTGACTGGGATGAGGACACTGACAGTGCCATAGGGAGCTTCCGCTATTCTTCCCGCAGTAATT
CTCAGAAACCCGAAACAGACACCGCCTCCTCCCTGGCTGTTTCTGATAGCTATGGAAGTGGCAGCAGAGCTGGCAAAGAGATGGATAGCAGTATTAATAA
GTGGCTCAGTGGCCTCAGGACAGAGGAAAAATCTCCTCCCCAAAGTGATTGGTCTGGAAGCTCCAGGGGGAAGTGCACCAGATCTTCCCTGCTCCGGGAG
ACAGAGTCTAAGTCCTCCAGTTATAAGTTCTCCAAATCCCAGTCAGAGGAACAGGACACCTCCTCCTACCACGAGGCCAATGGCAACTCTGTAAGAAGCA
CTTCGAAGTTCTCTGCTTCCTCCACCAGGGAGGGCAGAGAGATGCACACGTTCTCCAGGTCGACATTCAGTGAGACCTCAAGTTCTCGAGAGGAAAGCCC
AGAGCCCTACTTCTTCCGTCGGACCCCTGAGCCCTCTGAAGGGGAAGAGTCCCCAGAACCACGGCGTCCGAATTGGGCCAGACCCAGGGACTGGGAAGAT
GTGGAAGAGTCATCCAAGTCGGACTTTTCTGAATTTGGAGCCAAGAGGAAATTCACCCAGAGCTTCATGAGGTCTGAAGAGGAGGGGGAGAAAGAGAGGA
TGGAAAAGAGAGAAGAGGGGAGGTTTGCTTCAGGAAGGCGGTCCCAGTATCGGAGAAGCACTGACAGGGAGGAGGAGGAGGAAATGGACGATGAAGCCAT
CATTGCTGCCTGGAGACGCCGGCAAGAAGAAACCAGGACTAAGCTGCAGAGGAGGAGGGAAGATTAA


>BGISUSP0000888436
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
------------------------------------------------------NWIANVVSETLAQKQNEILLLSRSPSVASMKVAPAASCLGDDQVSM
LSGQSSSSLGGSLLPQSQARPSSDTQSVLSSHTTQSSRAEGTGSKVRGTSKPIYSLFADNVDLRELGRKEKEMQMELKEKMSEYKMEKLASDNKRSSLFK
KKKGRGDEDDDVGDWDEDTDSAIGSFRYSSRSNSQKPETDTASSLAVSDSYGSGSRAGKEMDSSINKWLSGLRTEEKSPPQSDWSGSSRGKCTRSSLLRE
TESKSSSYKFSKSQSEEQDTSSYHEANGNSVRSTSKFSASSTREGREMHTFSRSTFSETSSSREESPEPYFFRRTPEPSEGEESPEPRRPNWARPRDWED
VEESSKSDFSEFGAKRKFTQSFMRSEEEGEKERMEKREEGRFASGRRSQYRRSTDREEEEEMDDEAIIAAWRRRQEETRTKLQRRRED*