Sequences
EST Library Info
eje1Foetus 50 days, jejunum
fat1Fatt
gul1Gullet
lin1Large intestine
mgp1Mammary gland - 7 days pre birth
pliv4Unavailable
rec1Rectum
ret2Retina
sin1Small intestine
ski4Skin
sme1M. Semimembranosus
tra2Trachea
uio2Unavailable
vin1M. Vastus intermedius
Clusters
Oligos
SNPs

Gene ID ENSG00000198939 (click for geneview)
Transcript ID ENST00000361362(link to ensembl)
Symbol NP_085116.2
Localtion Chromosome:5:178255522:178292816:1 band: 5q35.3
Description hypothetical protein FLJ21628
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--E--R--E--G--I--W--H--S--T--L--G--E--T--W--E--P--N--N--W--L--E--G--Q--Q-----------D--S--H--L--S--
ATGGAAAGGGAAGGTATCTGGCATTCTACTCTAGGGGAAACCTGGGAACCTAATAATTGGTTAGAGGGACAACAG---------GATAGTCATCTGAGCC
::::::::::::::: ::::::::::: ::.::::::::::::::::::::.:::.::::::::::::.::::::         ::::: .:::::.:::
ATGGAAAGGGAAGGTCTCTGGCATTCTTCTTTAGGGGAAACCTGGGAACCTGATAGTTGGTTAGAGGGGCAACAGGAAAACCAAGATAGATATCTGGGCC
-M--E--R--E--G--L--W--H--S--S--L--G--E--T--W--E--P--D--S--W--L--E--G--Q--Q--E--N--Q--D--R--Y--L--G--

----------------------------------------------------------------------------------------------------
Q--V--G--V--T--H--K--E--T--F--T--E--M--R--V--C--G--G--N--E--F--E--R--C--S--S--Q--D--S--I--L--D--T--Q
AAGTGGGAGTTACCCATAAGGAAACCTTCACTGAGATGAGAGTATGTGGAGGTAATGAATTTGAAAGATGTTCCAGTCAGGATTCAATCCTTGATACACA
::: : .::::::::::::::::::..::: :::.: ..:... :.:::::::::::::::::::::::::::::.:::::.:::: :: ::::::::::
AAGAGCAAGTTACCCATAAGGAAACTCTCAATGAAAAAGGGACTTATGGAGGTAATGAATTTGAAAGATGTTCCAATCAGGGTTCATTCATTGATACACA
Q--E--Q--V--T--H--K--E--T--L--N--E--K--G--T--Y--G--G--N--E--F--E--R--C--S--N--Q--G--S--F--I--D--T--Q

----------------------------------------------------------------------------------------------------
--Q--S--I--P--M--V--K--R--P--H--N--C--N--S--H--G--E--D--A--T--Q--N--S--E--L--I--K--T--Q--R--M--F--V-
GCAAAGCATTCCTATGGTAAAAAGGCCCCATAACTGTAATTCACATGGAGAAGATGCCACACAAAATTCTGAGTTAATTAAAACTCAAAGAATGTTTGTA
. ::: .      :::: ..:::: .:. :..:.:: .::::: :::.:: :::..:.: : ::::..::::.::::::.::.:::.::.:::::::..:
AGAAACT------ATGGAGGAAAGTTCTAACGATTGGGATTCAGATGAAGTAGACACTAAAGAAAACCCTGAATTAATTGAAGCTCGAAAAATGTTTACA
--E--T--------M--E--E--S--S--N--D--W--D--S--D--E--V--D--T--K--E--N--P--E--L--I--E--A--R--K--M--F--T-

----------------------------------------------------------------------------------------------------
-G--K--K--I--Y--E--C--N--Q--C--S--K--T--F--S--Q--S--S--S--L--L--K--H--Q--R--I--H--T--G--E--K--P--Y--
GGAAAGAAGATCTATGAATGTAATCAGTGCAGCAAAACCTTCAGTCAGAGCTCATCCCTTCTTAAGCACCAGAGGATTCATACTGGGGAGAAACCCTATA
. ::::::.::::::  ::::::: ::::..: :::::::::: .:.::..:::::::::::::::::::::::::::::::: ::.::::::: :::::
ATAAAGAAAATCTATTTATGTAATGAGTGTGGGAAAACCTTCACCCGGAATTCATCCCTTCTTAAGCACCAGAGGATTCATACAGGAGAGAAACACTATA
-I--K--K--I--Y--L--C--N--E--C--G--K--T--F--T--R--N--S--S--L--L--K--H--Q--R--I--H--T--G--E--K--H--Y--

----------------------------------------------------------------------------------------------------
K--C--N--V--C--G--K--H--F--I--E--R--S--S--L--T--V--H--Q--R--I--H--T--G--E--K--P--Y--K--C--N--E--C--G
AGTGTAATGTATGTGGGAAACACTTCATTGAACGATCCTCCCTTACTGTACATCAAAGAATTCATACTGGAGAGAAACCCTATAAATGTAATGAATGTGG
:::::::::..::::::.:..::::: ::::::  :::::::::::::::::::::::::::::::::::::::::::::::.::::::::.:: :::::
AGTGTAATGCGTGTGGGGAGTACTTCCTTGAACTCTCCTCCCTTACTGTACATCAAAGAATTCATACTGGAGAGAAACCCTACAAATGTAACGATTGTGG
K--C--N--A--C--G--E--Y--F--L--E--L--S--S--L--T--V--H--Q--R--I--H--T--G--E--K--P--Y--K--C--N--D--C--G

----------------------------------------------------------------------------------------------------
--K--A--F--S--Q--S--M--N--L--T--V--H--Q--R--T--H--T--G--E--K--P--Y--Q--C--K--E--C--G--K--A--F--H--K-
GAAAGCCTTTAGTCAGAGCATGAATCTTACTGTCCATCAACGAACTCACACCGGAGAGAAACCCTATCAGTGTAAAGAGTGTGGCAAAGCCTTCCATAAG
::::.::::.: ::::::::::::.::::::::.:::::: :::.:::.::.:::::::.::: : :::::::::::::::::: ::.::.:::::.::.
GAAAACCTTCACTCAGAGCATGAACCTTACTGTTCATCAAAGAATTCATACTGGAGAGAGACCATTTCAGTGTAAAGAGTGTGGAAAGGCTTTCCACAAA
--K--T--F--T--Q--S--M--N--L--T--V--H--Q--R--I--H--T--G--E--R--P--F--Q--C--K--E--C--G--K--A--F--H--K-

----------------------------------------------------------------------------------------------------
-N--S--S--L--I--Q--H--E--R--I--H--T--G--E--K--P--Y--K--C--N--E--C--G--K--A--F--T--Q--S--M--N--L--T--
AATTCATCTCTTATTCAGCATGAAAGGATTCATACTGGAGAGAAACCCTACAAATGTAATGAATGTGGTAAAGCTTTTACCCAAAGCATGAATTTGACAG
:::::: :.:::: :::.:::::::::::::::::::::::::::::::::::::::::::: :::::::..::::::::::::::.::::::.: :.::
AATTCAGCCCTTAGTCAACATGAAAGGATTCATACTGGAGAGAAACCCTACAAATGTAATGATTGTGGTAGGGCTTTTACCCAAAGTATGAATCTCATAG
-N--S--A--L--S--Q--H--E--R--I--H--T--G--E--K--P--Y--K--C--N--D--C--G--R--A--F--T--Q--S--M--N--L--I--

----------------------------------------------------------------------------------------------------
V--H--Q--R--T--H--T--G--E--K--P--Y--E--C--N--E--C--G--K--A--F--S--Q--S--M--H--L--I--V--H--Q--R--S--H
TTCATCAGAGAACTCATACAGGAGAAAAACCCTATGAATGTAATGAATGTGGAAAAGCCTTCAGTCAAAGCATGCATCTTATTGTACATCAGAGAAGCCA
: :::::.:::::::::::::::::::::::.:::::::::::::::::.:::::::: :::::::::::.:::::.:::.::::::::::::::: .::
TGCATCAAAGAACTCATACAGGAGAAAAACCTTATGAATGTAATGAATGCGGAAAAGCATTCAGTCAAAGTATGCACCTTGTTGTACATCAGAGAACTCA
V--H--Q--R--T--H--T--G--E--K--P--Y--E--C--N--E--C--G--K--A--F--S--Q--S--M--H--L--V--V--H--Q--R--T--H

----------------------------------------------------------------------------------------------------
--T--G--E--K--P--Y--E--C--S--Q--C--G--K--A--F--S--K--S--S--T--L--T--L--H--Q--R--N--H--T--G--E--K--P-
TACTGGAGAAAAACCCTATGAGTGTAGTCAATGTGGAAAAGCCTTTAGTAAGAGCTCAACTCTTACCCTACATCAGCGAAATCACACTGGAGAAAAACCT
::::::::::::.::::::::::::::: :::::::.::::: :::::::::::::::.::::::::::.::: ::::: ::::.:: ::::::::.::.
TACTGGAGAAAAGCCCTATGAGTGTAGTGAATGTGGGAAAGCATTTAGTAAGAGCTCAGCTCTTACCCTGCATAAGCGACATCATACAGGAGAAAAGCCC
--T--G--E--K--P--Y--E--C--S--E--C--G--K--A--F--S--K--S--S--A--L--T--L--H--K--R--H--H--T--G--E--K--P-

----------------------------------------------------------------------------------------------------
-Y--K--C--N--K--C--G--K--S--F--S--Q--S--T--Y--L--I--E--H--Q--R--L--H--S--G--V--K--P--F--E--C--N--E--
TACAAATGTAACAAATGCGGGAAATCCTTTAGCCAAAGTACATATCTTATAGAACATCAGAGACTTCATTCTGGAGTAAAACCTTTTGAATGTAACGAGT
::::: :::::::::::.::::::::::::::::::::::::::.::::::: .:::::::::::::::::::::.::::::::: :::::::::.::::
TACAACTGTAACAAATGTGGGAAATCCTTTAGCCAAAGTACATACCTTATAGTGCATCAGAGACTTCATTCTGGAATAAAACCTTATGAATGTAATGAGT
-Y--N--C--N--K--C--G--K--S--F--S--Q--S--T--Y--L--I--V--H--Q--R--L--H--S--G--I--K--P--Y--E--C--N--E--

----------------------------------------------------------------------------------------------------
C--G--K--A--F--S--K--N--S--S--L--T--Q--H--R--R--I--H--T--G--E--K--P--Y--E--C--M--V--C--G--K--H--F--T
GTGGAAAAGCTTTCAGTAAGAATTCATCTCTAACTCAACATCGGAGAATTCACACTGGAGAGAAACCTTATGAGTGTATGGTGTGTGGAAAACATTTCAC
::::.:::.:::::::::::::::::::::: :::::.::::::::::::::.::::::::::::::::::::.:::.::.:.:::::::::::.:::::
GTGGGAAAACTTTCAGTAAGAATTCATCTCTTACTCAGCATCGGAGAATTCATACTGGAGAGAAACCTTATGAATGTGTGATATGTGGAAAACACTTCAC
C--G--K--T--F--S--K--N--S--S--L--T--Q--H--R--R--I--H--T--G--E--K--P--Y--E--C--V--I--C--G--K--H--F--T

----------------------------------------------------------------------------------------------------
--G--R--S--S--L--T--V--H--Q--V--I--H--T--G--E--K--P--Y--E--C--N--E--C--G--K--A--F--S--Q--S--A--Y--L-
TGGACGATCATCCCTTACCGTGCATCAGGTCATTCACACTGGAGAGAAACCTTATGAGTGCAATGAATGTGGAAAGGCATTCAGCCAGAGTGCTTACCTT
:: .::.:::::.:::: .:: :::: :::.:::::.:::::::::::.:::::: :.::...:: :::::::::::: :::::::::::.:  ::::::
TGCGCGGTCATCTCTTAATGTCCATCTGGTTATTCATACTGGAGAGAAGCCTTATCAATGTGGTGTATGTGGAAAGGCCTTCAGCCAGAGCGGATACCTT
--A--R--S--S--L--N--V--H--L--V--I--H--T--G--E--K--P--Y--Q--C--G--V--C--G--K--A--F--S--Q--S--G--Y--L-

----------------------------------------------------------------------------------------------------
-I--E--H--Q--R--I--H--T--G--E--K--P--Y--E--C--D--Q--C--G--K--A--F--I--K--N--S--S--L--T--V--H--Q--R--
ATTGAACATCAAAGAATTCATACTGGTGAGAAACCCTATGAATGTGATCAGTGTGGAAAAGCCTTCATTAAGAATTCATCCCTTACAGTGCATCAGAGAA
:::::.::::::::::::::::::::::::::.:::::::::::.:::::::::::::.:::::::::::::::::::::::::::::::::::::::::
ATTGAGCATCAAAGAATTCATACTGGTGAGAAGCCCTATGAATGCGATCAGTGTGGAAGAGCCTTCATTAAGAATTCATCCCTTACAGTGCATCAGAGAA
-I--E--H--Q--R--I--H--T--G--E--K--P--Y--E--C--D--Q--C--G--R--A--F--I--K--N--S--S--L--T--V--H--Q--R--

---------------------------------------------------------------------------------------------->
T--H--T--G--E--K--P--Y--Q--C--N--E--C--G--K--A--F--S--R--S--T--N--L--T--R--H--Q--R--T--H--T--*-
CTCATACAGGAGAGAAACCCTATCAGTGTAATGAATGCGGAAAAGCCTTCAGCCGGAGTACAAACCTTACACGACATCAAAGAACTCATACGTGA
.:::::::::::::::::: :::: ::::::::::::.::::.:::::::::.:::::::::::.::::::::::::::.:.:::::::      
TTCATACAGGAGAGAAACCGTATCTGTGTAATGAATGTGGAAGAGCCTTCAGTCGGAGTACAAATCTTACACGACATCAGAAAACTCAT------
I--H--T--G--E--K--P--Y--L--C--N--E--C--G--R--A--F--S--R--S--T--N--L--T--R--H--Q--K--T--H-------

Pig Consensus Sequence

>BGISUST0000876477
ATGGAAAGGGAAGGTCTCTGGCATTCTTCTTTAGGGGAAACCTGGGAACCTGATAGTTGGTTAGAGGGGCAACAGGAAAACCAAGATAGATATCTGGGCC
AAGAGCAAGTTACCCATAAGGAAACTCTCAATGAAAAAGGGACTTATGGAGGTAATGAATTTGAAAGATGTTCCAATCAGGGTTCATTCATTGATACACA
AGAAACTATGGAGGAAAGTTCTAACGATTGGGATTCAGATGAAGTAGACACTAAAGAAAACCCTGAATTAATTGAAGCTCGAAAAATGTTTACAATAAAG
AAAATCTATTTATGTAATGAGTGTGGGAAAACCTTCACCCGGAATTCATCCCTTCTTAAGCACCAGAGGATTCATACAGGAGAGAAACACTATAAGTGTA
ATGCGTGTGGGGAGTACTTCCTTGAACTCTCCTCCCTTACTGTACATCAAAGAATTCATACTGGAGAGAAACCCTACAAATGTAACGATTGTGGGAAAAC
CTTCACTCAGAGCATGAACCTTACTGTTCATCAAAGAATTCATACTGGAGAGAGACCATTTCAGTGTAAAGAGTGTGGAAAGGCTTTCCACAAAAATTCA
GCCCTTAGTCAACATGAAAGGATTCATACTGGAGAGAAACCCTACAAATGTAATGATTGTGGTAGGGCTTTTACCCAAAGTATGAATCTCATAGTGCATC
AAAGAACTCATACAGGAGAAAAACCTTATGAATGTAATGAATGCGGAAAAGCATTCAGTCAAAGTATGCACCTTGTTGTACATCAGAGAACTCATACTGG
AGAAAAGCCCTATGAGTGTAGTGAATGTGGGAAAGCATTTAGTAAGAGCTCAGCTCTTACCCTGCATAAGCGACATCATACAGGAGAAAAGCCCTACAAC
TGTAACAAATGTGGGAAATCCTTTAGCCAAAGTACATACCTTATAGTGCATCAGAGACTTCATTCTGGAATAAAACCTTATGAATGTAATGAGTGTGGGA
AAACTTTCAGTAAGAATTCATCTCTTACTCAGCATCGGAGAATTCATACTGGAGAGAAACCTTATGAATGTGTGATATGTGGAAAACACTTCACTGCGCG
GTCATCTCTTAATGTCCATCTGGTTATTCATACTGGAGAGAAGCCTTATCAATGTGGTGTATGTGGAAAGGCCTTCAGCCAGAGCGGATACCTTATTGAG
CATCAAAGAATTCATACTGGTGAGAAGCCCTATGAATGCGATCAGTGTGGAAGAGCCTTCATTAAGAATTCATCCCTTACAGTGCATCAGAGAATTCATA
CAGGAGAGAAACCGTATCTGTGTAATGAATGTGGAAGAGCCTTCAGTCGGAGTACAAATCTTACACGACATCAG---


>BGISUSP0000876477
MEREGLWHSSLGETWEPDSWLEGQQENQDRYLGQEQVTHKETLNEKGTYGGNEFERCSNQGSFIDTQETMEESSNDWDSDEVDTKENPELIEARKMFTIK
KIYLCNECGKTFTRNSSLLKHQRIHTGEKHYKCNACGEYFLELSSLTVHQRIHTGEKPYKCNDCGKTFTQSMNLTVHQRIHTGERPFQCKECGKAFHKNS
ALSQHERIHTGEKPYKCNDCGRAFTQSMNLIVHQRTHTGEKPYECNECGKAFSQSMHLVVHQRTHTGEKPYECSECGKAFSKSSALTLHKRHHTGEKPYN
CNKCGKSFSQSTYLIVHQRLHSGIKPYECNECGKTFSKNSSLTQHRRIHTGEKPYECVICGKHFTARSSLNVHLVIHTGEKPYQCGVCGKAFSQSGYLIE
HQRIHTGEKPYECDQCGRAFIKNSSLTVHQRIHTGEKPYLCNECGRAFSRSTNLTRHQ-