Sequences
EST Library Info
pigca3Unavailable
Clusters
Oligos
SNPs

Gene ID ENSG00000198920 (click for geneview)
Transcript ID ENST00000361413(link to ensembl)
Symbol NP_055619.1
Localtion Chromosome:17:6422375:6484716:-1 band: 17p13.1
Description KIAA0753 gene product
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-Q--G--C--H--Y--C--S--V--L--P--D--I--M--G--P--G--Q--P--A--S--T--C--V--H--L--A--P--R--T--Q--L--D--G--
CAAGGCTGTCACTATTGTTCTGTACTACCTGACATTATGGGACCAGGCCAGCCAGCTTCAACCTGTGTTCATCTAGCACCTAGGACCCAACTTGATGGGA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------><----------------------------------------------------------------------
R--S--D--P--K--V--L--Q--T--Q--N--Q--L--Q--F--N--R--N--V--P--T--H--S--S--N--L--A--I--R--Y--S--C--P--H
GGAGCGACCCCAAAGTACTTCAGACCCAGAACCAGCTGCAGTTTAATAGGAATGTTCCTACACATTCAAGCAACTTGGCGATCCGATATTCTTGCCCACA
                             ::::::::::::::::::::::::::::::::::::::.:::::::::::.::::: ::.:::::::::::
-----------------------------AACCAGCTGCAGTTTAATAGGAATGTTCCTACACATTCGAGCAACTTGGCAATCCGCTACTCTTGCCCACA
------------------------------N--Q--L--Q--F--N--R--N--V--P--T--H--S--S--N--L--A--I--R--Y--S--C--P--H

----------------------------------------------------------------------------------------------------
--A--I--R--I--E--K--L--K--H--S--Y--N--E--S--Y--H--C--K--D--A--D--C--R--V--G--P--D--L--G--S--S--V--S-
TGCCATTAGAATTGAAAAACTGAAGCACTCATACAATGAATCATACCATTGTAAAGATGCAGATTGTAGAGTTGGTCCTGACCTGGGCAGTTCTGTTTCA
::  ::::::::::::::::::::::::::::.::::::.::: :.:: ::::.:::.               :::::::::::..:::::::::::::.
TGGAATTAGAATTGAAAAACTGAAGCACTCATGCAATGAGTCAGATCAGTGTAGAGAC---------------GGTCCTGACCTAAGCAGTTCTGTTTCG
--G--I--R--I--E--K--L--K--H--S--C--N--E--S--D--Q--C--R--D-----------------G--P--D--L--S--S--S--V--S-

----------------------------------------------------------------------------------------------------
-F--S--V--I--S--Q--E--R--L--S--Y--A--V--H--L--A--R--R--D--V--K--R--R--Q--F--E--K--H--I--K--E--H--H--
TTTTCCGTCATATCCCAAGAGAGACTTAGCTATGCTGTCCACCTAGCCAGAAGAGATGTGAAACGAAGACAATTTGAAAAACATATAAAAGAACATCATC
:::::.::::::::  :::::::::::::::::::.:::::::::::::..::.:::::.::.::.:::::..:::::                      
TTTTCTGTCATATCAGAAGAGAGACTTAGCTATGCCGTCCACCTAGCCAAGAGGGATGTAAAGCGGAGACAGCTTGAA----------------------
-F--S--V--I--S--E--E--R--L--S--Y--A--V--H--L--A--K--R--D--V--K--R--R--Q--L--E-----------------------

----------------------------------------------------------------------------------------------------
L--R--S--Q--P--Q--S--S--Q--K--C--G--H--T--K--Y--K--I--P--D--H--R--V--E--R--K--E--S--K--S--Q--A--A--C
TCAGAAGTCAGCCTCAAAGCTCTCAGAAGTGTGGACATACTAAGTATAAAATACCCGACCACAGGGTGGAAAGGAAGGAATCAAAGAGTCAAGCAGCCTG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--Q--C--S--H--Q--P--S--K--V--E--I--S--S--S--G--A--K--V--Y--L--Y--S--S--H--P--G--Q--S--D--L--T--V--P-
TCAGTGTAGCCACCAGCCATCCAAAGTAGAAATCTCCAGCTCTGGTGCCAAAGTATACCTTTACTCATCTCATCCAGGCCAGTCAGATCTTACTGTGCCA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-N--S--P--P--T--H--D--P--G--L--Q--P--H--P--R--I--G--D--H--K--N--I--S--E--Q--K--S--L--L--E--V--Q--R--
AATTCGCCACCCACCCATGATCCGGGACTTCAGCCTCATCCCAGGATAGGTGACCACAAAAACATAAGTGAACAGAAAAGCCTGCTAGAAGTCCAGCGAC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-----------------------------------------------------><---------------------------------------------
L--Q--K--E--L--S--S--C--I--H--K--I--E--E--V--T--K--K--D--R--L--E--E--A--L--D--P--D--E--E--R--R--I--R
TCCAGAAAGAACTGAGCAGTTGTATCCACAAAATTGAAGAGGTAACTAAAAAAGATAGACTAGAAGAAGCTTTGGATCCAGATGAAGAACGTCGAATCCG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

------------------------------------------------------------><--------------------------------------
--I--R--R--Q--E--Q--A--A--R--S--A--R--M--L--Y--V--L--Q--Q--Q--V--K--E--I--Q--E--E--L--D--K--L--S--P-
TATCAGGAGACAGGAGCAAGCTGCTCGCTCTGCCCGAATGCTCTACGTCCTCCAGCAGCAGGTAAAAGAAATCCAGGAAGAATTGGATAAATTGAGTCCA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-----------------------><---------------------------------------------------------------------------
-H--K--I--K--H--T--K--K--S--W--A--M--S--K--L--A--A--A--H--R--G--A--I--R--A--L--Q--M--F--V--T--Q--F--
CATAAAATTAAACACACTAAGAAGTCATGGGCAATGTCTAAGCTGGCGGCTGCCCATCGAGGAGCCATTCGGGCCTTACAGATGTTTGTCACTCAGTTTA
                        :: ::::::.::::.:.::::::.:::::::::::::::::::::::::::::::::::::::::.::::::::::
------------------------TCCTGGGCAGTGTCCAGGCTGGCAGCTGCCCATCGAGGAGCCATTCGGGCCTTACAGATGTTTGTTACTCAGTTTA
-------------------------S--W--A--V--S--R--L--A--A--A--H--R--G--A--I--R--A--L--Q--M--F--V--T--Q--F--

----------------------------------------------------------------------------------------------------
T--D--R--G--E--H--P--L--P--A--R--C--K--E--L--G--S--L--I--R--Q--L--S--L--C--S--V--K--L--D--A--D--P--S
CTGACCGAGGGGAGCATCCACTTCCTGCTCGGTGTAAGGAACTGGGCAGCCTTATTCGCCAGCTTTCACTTTGTTCTGTCAAGCTGGATGCAGACCCTTC
:.::::::::::::::.:::::::::::::::::.:.:::.:::::::::::.:::::::::::::::::.:::::::.::::.:::: :: ::..::::
CCGACCGAGGGGAGCACCCACTTCCTGCTCGGTGCAGGGAGCTGGGCAGCCTCATTCGCCAGCTTTCACTCTGTTCTGCCAAGTTGGAGGCCGATTCTTC
T--D--R--G--E--H--P--L--P--A--R--C--R--E--L--G--S--L--I--R--Q--L--S--L--C--S--A--K--L--E--A--D--S--S

---------------------------------------><-----------------------------------------------------------
--V--P--D--V--V--I--D--I--L--Q--Q--I--E--A--L--E--S--L--L--E--K--K--L--S--P--K--K--V--K--K--C--F--S-
TGTTCCTGATGTGGTTATAGATATTCTGCAACAAATTGAGGCTTTGGAATCTCTCCTGGAAAAGAAACTGTCACCAAAAAAGGTGAAAAAATGTTTCAGT
::::::::::::::::::::::::.:::::::::::.::::::::::::::.:::::::::::::::::::::::.:::::::.:::. :::::::::::
TGTTCCTGATGTGGTTATAGATATCCTGCAACAAATCGAGGCTTTGGAATCCCTCCTGGAAAAGAAACTGTCACCGAAAAAGGCGAAGCAATGTTTCAGT
--V--P--D--V--V--I--D--I--L--Q--Q--I--E--A--L--E--S--L--L--E--K--K--L--S--P--K--K--A--K--Q--C--F--S-

----------------------------------------------------------------------------------------------------
-E--I--R--S--R--F--P--I--G--S--Q--K--A--L--E--R--W--P--S--T--S--P--K--G--E--R--R--P--L--T--A--K--D--
GAAATTCGGAGCAGATTTCCTATCGGTAGCCAAAAGGCCTTGGAGAGATGGCCAAGTACATCACCAAAGGGTGAGAGGAGGCCCCTCACAGCAAAGGACA
::::::::::::::.:::::..:.:::: :::.:.::::::.:: ::::::: :::.::::: ::::::.::::::::::::::::...:::.::::: .
GAAATTCGGAGCAGGTTTCCCGTTGGTACCCAGAGGGCCTTAGACAGATGGCGAAGCACATCCCCAAAGAGTGAGAGGAGGCCCCTTGTAGCGAAGGAGG
-E--I--R--S--R--F--P--V--G--T--Q--R--A--L--D--R--W--R--S--T--S--P--K--S--E--R--R--P--L--V--A--K--E--

--------------------------------------------------><------------------------------------------------
T--F--P--Q--E--T--S--R--P--S--V--A--K--Q--L--L--A--D--K--Y--Q--P--D--T--E--L--P--E--T--Q--R--L--Q--S
CATTCCCACAGGAAACAAGTCGACCTTCTGTAGCAAAGCAGCTTCTTGCCGATAAGTATCAGCCCGATACGGAGCTTCCGGAGACCCAGAGGTTGCAGAG
.:::.:.:::::::::::: ::::::.: ::::::::: ::::::::                                                     
TATTTCTACAGGAAACAAGACGACCTCCAGTAGCAAAGAAGCTTCTT-----------------------------------------------------
V--F--L--Q--E--T--R--R--P--P--V--A--K--K--L--L------------------------------------------------------

----------------------------------------------------------------------------------------------------
--E--L--D--V--L--D--A--D--I--V--L--E--E--G--P--F--I--L--D--Q--S--A--S--F--K--D--E--V--L--A--V--A--K-
TGAGCTTGATGTATTAGATGCGGATATAGTTCTGGAAGAAGGACCATTTATTCTAGACCAAAGTGCAAGCTTCAAAGACGAGGTGTTAGCCGTGGCAAAA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

--------------------------------------------------------------------------------><------------------
-T--K--A--G--K--K--K--P--V--T--E--N--V--P--F--R--K--K--D--T--L--A--P--A--R--Q--Q--G--L--R--K--A--E--
ACAAAAGCAGGGAAAAAGAAGCCTGTGACTGAGAATGTGCCGTTTAGGAAGAAAGATACTCTGGCGCCAGCAAGACAGCAAGGACTCCGCAAAGCTGAAA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
R--G--R--Q--S--Q--P--H--S--K--S--R--V--Q--Q--T--T--V--S--S--R--L--K--M--N--R--Q--P--V--K--D--R--K--A
GAGGTAGACAAAGCCAACCTCACAGTAAAAGCAGAGTGCAGCAGACAACAGTTTCATCCAGATTAAAAATGAACCGGCAGCCTGTGAAAGACCGCAAGGC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-----------------------------------------------><---------------------------------------------------
--P--W--I--P--P--N--P--T--S--P--P--A--S--P--K--C--A--A--W--L--K--V--K--T--S--P--R--D--A--T--K--E--P-
ACCATGGATACCCCCAAACCCCACATCCCCACCAGCGTCTCCTAAATGTGCTGCATGGCTAAAGGTGAAAACTAGCCCCAGAGATGCCACAAAAGAGCCT
                                                 ::::: ::::::::::::::: ::::::::: :::::::::::::::.:  
-------------------------------------------------GCTGCCTGGCTAAAGGTGAAATCTAGCCCCACAGATGCCACAAAAGAACAG
--------------------------------------------------A--A--W--L--K--V--K--S--S--P--T--D--A--T--K--E--Q-

-------------------------------------------------------------------><-------------------------------
----L--Q--Q--E--D--P--Q--E--E--S--H--L--T--G--A--V--E--H--E--A--A--R--L--A--W--L--D--A--E--T--S--K--
---CTCCAGCAAGAAGATCCTCAAGAGGAAAGTCACCTGACAGGTGCTGTTGAGCATGAAGCAGCCAGGCTCGCTTGGCTTGATGCTGAAACTTCCAAAA
   ::::::: ::::::: ::: :::::::::.:: :::: :::::::.:.: ::::::::::      ::::::::::::::::. :::::::::::.:
TCTCTCCAGCCAGAAGATGCTCCAGAGGAAAGCCAGCTGAGAGGTGCTATCGCGCATGAAGCA------CTCGCTTGGCTTGATGTGGAAACTTCCAAGA
-S--L--Q--P--E--D--A--P--E--E--S--Q--L--R--G--A--I--A--H--E--A--------L--A--W--L--D--V--E--T--S--K--

---------------------------------------------------------><-----------------------------------------
R--L--K--E--L--E--E--L--K--A--K--E--I--D--S--M--Q--K--Q--R--L--D--W--L--D--A--E--T--S--R--R--T--K--E
GATTGAAGGAACTAGAAGAGTTAAAAGCCAAGGAAATTGACAGCATGCAAAAACAGAGGCTTGATTGGCTTGATGCTGAAACTTCTAGAAGAACAAAGGA
::::::::: :.:::::::.::::::: ..:.::::: ::::: ::::::::::::                                            
GATTGAAGGCATTAGAAGAATTAAAAGATGAAGAAATGGACAGAATGCAAAAACAG--------------------------------------------
R--L--K--A--L--E--E--L--K--D--E--E--M--D--R--M--Q--K--Q---------------------------------------------

-----------------------------------------------><---------------------------------------------------
--L--N--E--L--K--A--E--E--M--Y--R--L--Q--Q--L--S--V--S--A--T--H--L--A--D--K--V--E--E--A--V--L--D--R-
ACTGAATGAGCTCAAAGCTGAAGAAATGTATAGACTCCAACAATTGAGTGTTTCTGCCACCCACTTAGCAGACAAGGTAGAGGAGGCAGTTCTGGATCGT
                                                 :::::::::::::: :::::.:::::.::.:::.:::::::.::::: :::
-------------------------------------------------GTTTCTGCCACCCAGTTAGCGGACAAAGTGGAGAAGGCAGTCCTGGAGCGT
--------------------------------------------------V--S--A--T--Q--L--A--D--K--V--E--K--A--V--L--E--R-

--------------------------><------------------------------------------------------------------------
-L--K--P--L--L--V--K--A--Q--R--V--N--S--T--T--E--A--N--I--H--L--K--D--G--S--S--V--N--T--A--K--A--Q--
TTGAAGCCTCTCTTGGTCAAGGCCCAGAGAGTCAATTCTACTACAGAAGCAAATATTCATTTGAAAGATGGCTCGTCAGTAAACACAGCGAAAGCCCAGC
:::::::::::::::::::::::::::                                                                         
TTGAAGCCTCTCTTGGTCAAGGCCCAG-------------------------------------------------------------------------
-L--K--P--L--L--V--K--A--Q--------------------------------------------------------------------------

----------><----------------------------------------------------------------------------------------
P--A--Q--E--V--A--A--V--D--F--E--S--N--N--I--R--Q--L--D--D--F--L--E--D--C--A--S--E--L--W--A--V--T--H
CTGCACAGGAGGTTGCAGCTGTTGATTTTGAATCCAACAACATTCGTCAGCTTGATGATTTTTTGGAAGATTGTGCCAGTGAGCTCTGGGCTGTGACTCA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

------------------------------------------------------------------------------------------------><--
--A--K--I--L--G--S--E--T--L--A--T--V--E--D--S--K--D--S--P--D--L--E--I--M--M--R--R--M--E--E--M--E--K-
TGCTAAGATCTTGGGGTCTGAAACCTTAGCCACCGTTGAGGACAGCAAGGATAGCCCAGATCTGGAGATCATGATGCGCCGAATGGAAGAGATGGAAAAA
                                                                                                 :::
-------------------------------------------------------------------------------------------------AAA
--------------------------------------------------------------------------------------------------K-

------------------------------------------------------------------------------><--------------------
-Y--Q--E--S--V--R--Q--R--Y--N--K--I--A--Y--A--D--P--R--L--W--M--Q--E--E--N--N--D--Q--K--I--S--A--I--
TACCAGGAGTCTGTTCGTCAAAGATATAATAAAATCGCATATGCTGATCCTCGACTTTGGATGCAGGAAGAAAACAATGACCAAAAAATCTCAGCAATAA
::::::::: : :::::.::::::::.:.:: :::.:.::::.:.:::::::. ::::::::::::::::::         ::::: :::.:::::.:::
TACCAGGAGACAGTTCGCCAAAGATACAGTACAATTGTATATACCGATCCTCATCTTTGGATGCAGGAAGAA---------CAAAACATCCCAGCAGTAA
-Y--Q--E--T--V--R--Q--R--Y--S--T--I--V--Y--T--D--P--H--L--W--M--Q--E--E-----------Q--N--I--P--A--V--

--------------------------------------------------------------------------------------------------->
S--E--K--P--L--S--P--H--P--I--R--I--T--K--T--V--D--R--K--D--P--A--V--N--I--M--L--E--R--P--C--N--G--N
GTGAAAAGCCTCTATCTCCTCATCCAATCAGAATCACGAAGACAGTGGATCGCAAGGATCCAGCCGTGAACATCATGTTAGAAAGGCCCTGTAATGGCAA
::::::.:::::: :::::::::::::::::.:::::.:::::::..: ::::::.::.:: : :::::::::..:.::.::.::::::::.::.     
GTGAAAGGCCTCTTTCTCCTCATCCAATCAGGATCACAAAGACAGCAGCTCGCAAAGACCCCGACGTGAACATTGTATTGGAGAGGCCCTGCAAC-----
S--E--R--P--L--S--P--H--P--I--R--I--T--K--T--A--A--R--K--D--P--D--V--N--I--V--L--E--R--P--C--N------

<---------------------------------------------------------------------------------------------------
--S--L--D--E--S--V--G--T--E--E--G--S--E--K--R--E--A--P--L--L--S--L--A--E--D--S--Q--Q--K--E--G--R--A-
TTCCCTGGATGAAAGTGTGGGAACAGAGGAAGGATCAGAGAAAAGAGAGGCCCCTCTTCTCTCCCTAGCCGAAGATTCTCAACAGAAAGAAGGCCGAGCT
 ::::::::::::::::::::::::::.::..::::.::::::::::::::.::.:::::::::::  : :::::.:::: .::::..::.:::::.:. 
-TCCCTGGATGAAAGTGTGGGAACAGAAGAGAGATCGGAGAAAAGAGAGGCTCCCCTTCTCTCCCTTTCAGAAGACTCTCTGCAGAGGGAGGGCCGGGTG
--S--L--D--E--S--V--G--T--E--E--R--S--E--K--R--E--A--P--L--L--S--L--S--E--D--S--L--Q--R--E--G--R--V-

----------------------------------------------------------------------------------------------------
-P--L--F--V--P--P--G--M--Q--H--S--I--G--D--Y--C--S--R--F--E--Q--Y--L--R--I--I--S--H--E--A--V--G--S--
CCCCTCTTTGTCCCACCGGGTATGCAGCACAGCATCGGTGACTACTGTAGTCGTTTTGAGCAGTACCTTCGGATCATATCTCATGAGGCTGTAGGCTCCT
 ::::::.::::::.:::::.:::..::.::::::::::::::::::.::.::.:::::::: :::::.:::.: .:. : ::.:::::.::.::: :::
GCCCTCTCTGTCCCGCCGGGCATGTGGCGCAGCATCGGTGACTACTGCAGCCGCTTTGAGCACTACCTCCGGGTGGTGGCACACGAGGCCGTGGGCGCCT
-A--L--S--V--P--P--G--M--W--R--S--I--G--D--Y--C--S--R--F--E--H--Y--L--R--V--V--A--H--E--A--V--G--A--

------------------------><--------------------------------------------------------------------------
F--N--P--W--L--I--A--E--S--F--S--E--E--L--V--D--E--A--L--G--A--V--A--A--E--L--Q--D--M--C--E--D--Y--A
TCAACCCGTGGCTGATAGCTGAAAGCTTTTCAGAAGAGCTGGTAGATGAAGCTCTGGGTGCTGTGGCTGCTGAACTTCAGGATATGTGCGAAGATTATGC
::::::: :::::::::::::::   :::::::: :::::::::::::::::.::::: ::.:::::::::::::::::::::.::::.:::::::::::
TCAACCCCTGGCTGATAGCTGAA---TTTTCAGACGAGCTGGTAGATGAAGCCCTGGGGGCCGTGGCTGCTGAACTTCAGGATGTGTGTGAAGATTATGC
F--N--P--W--L--I--A--E-----F--S--D--E--L--V--D--E--A--L--G--A--V--A--A--E--L--Q--D--V--C--E--D--Y--A

------------------------------------------>
--E--A--V--F--T--S--E--F--L--E--A--A--T--*-
AGAAGCTGTGTTCACCTCAGAATTCTTAGAGGCTGCTACATAA
::::::.::::::::::::::::::::.::::: :::::::::
AGAAGCCGTGTTCACCTCAGAATTCTTGGAGGCGGCTACATAA
--E--A--V--F--T--S--E--F--L--E--A--A--T--*-

Pig Consensus Sequence

>BGISUST0000881405
----------------------------------------------------------------------------------------------------
-----------------------------AACCAGCTGCAGTTTAATAGGAATGTTCCTACACATTCGAGCAACTTGGCAATCCGCTACTCTTGCCCACA
TGGAATTAGAATTGAAAAACTGAAGCACTCATGCAATGAGTCAGATCAGTGTAGAGACGGTCCTGACCTAAGCAGTTCTGTTTCGTTTTCTGTCATATCA
GAAGAGAGACTTAGCTATGCCGTCCACCTAGCCAAGAGGGATGTAAAGCGGAGACAGCTTGAA-------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
---------TCCTGGGCAGTGTCCAGGCTGGCAGCTGCCCATCGAGGAGCCATTCGGGCCTTACAGATGTTTGTTACTCAGTTTACCGACCGAGGGGAGC
ACCCACTTCCTGCTCGGTGCAGGGAGCTGGGCAGCCTCATTCGCCAGCTTTCACTCTGTTCTGCCAAGTTGGAGGCCGATTCTTCTGTTCCTGATGTGGT
TATAGATATCCTGCAACAAATCGAGGCTTTGGAATCCCTCCTGGAAAAGAAACTGTCACCGAAAAAGGCGAAGCAATGTTTCAGTGAAATTCGGAGCAGG
TTTCCCGTTGGTACCCAGAGGGCCTTAGACAGATGGCGAAGCACATCCCCAAAGAGTGAGAGGAGGCCCCTTGTAGCGAAGGAGGTATTTCTACAGGAAA
CAAGACGACCTCCAGTAGCAAAGAAGCTTCTT--------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------GCTGCCTGGCTAAAGGTGAAATCTAGCCCCACAGATGCCACAAAAGAACAGTCTCTCCAGCCAGAA
GATGCTCCAGAGGAAAGCCAGCTGAGAGGTGCTATCGCGCATGAA------CTCGCTTGGCTTGATGTGGAAACTTCCAAGAGATTGAAGGCATTAGAAG
AATTAAAAGATGAAGAAATGGACAGAATGCAAAAACAG--------------------------------------------------------------
-------------------------------GTTTCTGCCACCCAGTTAGCGGACAAAGTGGAGAAGGCAGTCCTGGAGCGTTTGAAGCCTCTCTTGGTC
AAGGCCCAG-------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
-------------------------------------------------------------------------------AAATACCAGGAGACAGTTCGC
CAAAGATACAGTACAATTGTATATACCGATCCTCATCTTTGGATGCAGGAAGAA---------CAAAACATCCCAGCAGTAAGTGAAAGGCCTCTTTCTC
CTCATCCAATCAGGATCACAAAGACAGCAGCTCGCAAAGACCCCGACGTGAACATTGTATTGGAGAGGCCCTGCAAC------TCCCTGGATGAAAGTGT
GGGAACAGAAGAGAGATCGGAGAAAAGAGAGGCTCCCCTTCTCTCCCTTTCAGAAGACTCTCTGCAGAGGGAGGGCCGGGTGGCCCTCTCTGTCCCGCCG
GGCATGTGGCGCAGCATCGGTGACTACTGCAGCCGCTTTGAGCACTACCTCCGGGTGGTGGCACACGAGGCCGTGGGCGCCTTCAACCCCTGGCTGATAG
CTGAA---TTTTCAGACGAGCTGGTAGATGAAGCCCTGGGGGCCGTGGCTGCTGAACTTCAGGATGTGTGTGAAGATTATGCAGAAGCCGTGTTCACCTC
AGAATTCTTGGAGGCGGCTACATAA


>BGISUSP0000881405
-------------------------------------------NQLQFNRNVPTHSSNLAIRYSCPHGIRIEKLKHSCNESDQCRDGPDLSSSVSFSVIS
EERLSYAVHLAKRDVKRRQLE-------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
---SWAVSRLAAAHRGAIRALQMFVTQFTDRGEHPLPARCRELGSLIRQLSLCSAKLEADSSVPDVVIDILQQIEALESLLEKKLSPKKAKQCFSEIRSR
FPVGTQRALDRWRSTSPKSERRPLVAKEVFLQETRRPPVAKKLL--------------------------------------------------------
------------------------------------------------------------------------------AAWLKVKSSPTDATKEQSLQPE
DAPEESQLRGAIAHE--LAWLDVETSKRLKALEELKDEEMDRMQKQ-------------------------------VSATQLADKVEKAVLERLKPLLV
KAQ------------------------------------------------------------------------------------------KYQETVR
QRYSTIVYTDPHLWMQEE---QNIPAVSERPLSPHPIRITKTAARKDPDVNIVLERPCN--SLDESVGTEERSEKREAPLLSLSEDSLQREGRVALSVPP
GMWRSIGDYCSRFEHYLRVVAHEAVGAFNPWLIAE-FSDELVDEALGAVAAELQDVCEDYAEAVFTSEFLEAAT*