Sequences
EST Library Info
aor2Aorta
csk2Skin - RNA from China
spl2Spleen
ton1Tip of tongue, mucosal membrane
Clusters
Oligos
SNPs

Gene ID ENSG00000119979 (click for geneview)
Transcript ID ENST00000361432(link to ensembl)
Symbol FAM45A
Localtion Chromosome:10:120853601:120887205:1 band: 10q26.11
Description Protein FAM45A. [Source:Uniprot/SWISSPROT;Acc:Q8TCE6]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<-----------------------------------------------------><--------------------------------------------
-M--A--A--A--E--V--A--D--T--Q--L--M--L--G--V--G--L--I--E--K--D--T--N--G--E--V--L--W--V--W--C--Y--P--
ATGGCTGCGGCCGAGGTGGCGGACACTCAGCTGATGCTTGGAGTCGGGCTGATCGAAAAGGACACAAATGGAGAAGTTCTGTGGGTGTGGTGTTATCCTT
                                                         :::::::::::::::::::::::::::::::::::::::::::
---------------------------------------------------------AAGGACACAAATGGAGAAGTTCTGTGGGTGTGGTGTTATCCTT
----------------------------------------------------------K--D--T--N--G--E--V--L--W--V--W--C--Y--P--

----------------------------------------------------------------------------------------------------
S--T--T--A--T--L--R--N--L--L--L--R--K--C--C--L--T--D--E--N--K--L--L--H--P--F--V--F--G--Q--Y--R--R--T
CCACGACAGCCACATTAAGGAACCTGCTGCTGAGAAAATGCTGCCTTACAGATGAAAACAAACTTCTCCATCCCTTTGTCTTTGGTCAGTACAGAAGAAC
::::::::::.:: ::::::::.::::::::: :::::::::::::::::::::::::::.:::::::::::::::::::: ::::::::::::::::::
CCACGACAGCTACTTTAAGGAATCTGCTGCTGCGAAAATGCTGCCTTACAGATGAAAACAGACTTCTCCATCCCTTTGTCTATGGTCAGTACAGAAGAAC
S--T--T--A--T--L--R--N--L--L--L--R--K--C--C--L--T--D--E--N--R--L--L--H--P--F--V--Y--G--Q--Y--R--R--T

---------------------------------------------------><-----------------------------------------------
--W--F--Y--I--T--T--I--E--V--P--D--S--S--I--L--K--K--V--T--H--F--S--I--V--L--T--A--K--D--F--N--P--E-
ATGGTTTTATATCACAACAATTGAAGTTCCAGATTCTTCCATTTTGAAAAAGGTGACTCATTTTTCTATTGTCCTGACCGCCAAAGATTTTAACCCAGAG
 ::::::::::::::::::.: ::::: :::::: :::::.:::::::::::::::::::::::::::::::.::::::::::::::::::::.::::::
CTGGTTTTATATCACAACAGTGGAAGTGCCAGATGCTTCCGTTTTGAAAAAGGTGACTCATTTTTCTATTGTTCTGACCGCCAAAGATTTTAATCCAGAG
--W--F--Y--I--T--T--V--E--V--P--D--A--S--V--L--K--K--V--T--H--F--S--I--V--L--T--A--K--D--F--N--P--E-

-------------------------------><-------------------------------------------------------------------
-K--Y--A--A--F--T--R--I--L--C--R--M--Y--L--K--H--G--S--P--V--K--M--M--E--S--Y--I--A--V--L--T--K--G--
AAGTATGCTGCCTTCACTAGGATATTGTGTAGAATGTACCTGAAACATGGGAGCCCAGTTAAAATGATGGAGAGTTATATTGCAGTTCTCACAAAGGGGA
::.:::::.:::::::::::::::::::::   ::::::::::::::.:::::::::::::::::::::::::::::.::.:: ::::::::.:::::::
AAATATGCCGCCTTCACTAGGATATTGTGT---ATGTACCTGAAACACGGGAGCCCAGTTAAAATGATGGAGAGTTACATCGCTGTTCTCACGAAGGGGA
-K--Y--A--A--F--T--R--I--L--C-----M--Y--L--K--H--G--S--P--V--K--M--M--E--S--Y--I--A--V--L--T--K--G--

--------------------------------------------------------------------------------><------------------
I--C--Q--S--E--E--N--G--S--F--L--S--K--D--F--D--A--R--K--A--Y--L--A--G--S--I--K--D--I--V--S--Q--F--G
TATGCCAGAGTGAAGAAAACGGCTCTTTCCTTAGTAAGGATTTTGATGCCCGAAAGGCCTACCTGGCTGGCTCCATCAAAGACATTGTATCTCAGTTTGG
: :::::.:::::::::::.::::::::::::::.:::::.::::::::::::::.:: ::::: :: ::::::::::::   :::::::::::::::::
TTTGCCAAAGTGAAGAAAATGGCTCTTTCCTTAGCAAGGACTTTGATGCCCGAAAAGCATACCTTGCAGGCTCCATCAAA---ATTGTATCTCAGTTTGG
I--C--Q--S--E--E--N--G--S--F--L--S--K--D--F--D--A--R--K--A--Y--L--A--G--S--I--K-----I--V--S--Q--F--G

--------------------------------------------------------------------------------------------><------
--M--E--T--V--I--L--H--T--A--L--M--L--K--K--R--I--V--V--Y--H--P--K--I--E--A--V--Q--E--F--T--R--T--L-
AATGGAAACTGTTATCTTACACACAGCACTGATGCTAAAGAAAAGAATTGTGGTGTATCACCCCAAGATAGAAGCGGTCCAGGAGTTCACCAGGACTCTG
:::::::::::::::::::::::::::::::::::::::::::::.::::: :: :::::::::::.:::::::: :::::::::::.:::   ::::: 
AATGGAAACTGTTATCTTACACACAGCACTGATGCTAAAGAAAAGGATTGTCGTCTATCACCCCAAAATAGAAGCTGTCCAGGAGTTTACC---ACTCTC
--M--E--T--V--I--L--H--T--A--L--M--L--K--K--R--I--V--V--Y--H--P--K--I--E--A--V--Q--E--F--T-----T--L-

---------------------------------------------------------------------------------------------><-----
-P--A--L--V--W--H--R--Q--D--W--T--I--L--H--S--Y--V--H--L--N--A--D--E--L--E--A--L--Q--M--C--T--G--Y--
CCTGCCCTGGTGTGGCACCGACAGGACTGGACCATCCTTCACTCTTACGTGCACCTCAACGCCGATGAGCTGGAAGCCCTGCAGATGTGCACAGGTTACG
:::::::::::::::::.::::::::::::::::::::::::::.::.:::::::: .:::::::::::::::::::::::::::::::.      ::::
CCTGCCCTGGTGTGGCATCGACAGGACTGGACCATCCTTCACTCCTATGTGCACCTGGACGCCGATGAGCTGGAAGCCCTGCAGATGTGT------TACG
-P--A--L--V--W--H--R--Q--D--W--T--I--L--H--S--Y--V--H--L--D--A--D--E--L--E--A--L--Q--M--C--------Y--

----------------------------------------------------------------------------------------------------
V--A--G--F--V--D--L--E--V--S--N--R--P--D--L--Y--D--V--F--V--N--L--A--E--S--E--I--T--I--A--P--L--A--K
TCGCTGGATTTGTAGACTTGGAGGTGAGCAACAGACCAGACCTCTATGATGTGTTTGTGAATCTGGCAGAGAGTGAGATTACCATTGCTCCCCTTGCAAA
::::::: ::::: :::::::::::::::::.:::.::::::: ::.::::::::::::::::::::::: :::::::::::::::::::: ::.:::::
TCGCTGGCTTTGTCGACTTGGAGGTGAGCAATAGATCAGACCTGTACGATGTGTTTGTGAATCTGGCAGATAGTGAGATTACCATTGCTCCGCTCGCAAA
V--A--G--F--V--D--L--E--V--S--N--R--S--D--L--Y--D--V--F--V--N--L--A--D--S--E--I--T--I--A--P--L--A--K

-><---------------------------------------------------------------------------------------------><--
--E--A--M--A--M--G--K--L--H--K--E--M--G--Q--L--I--V--Q--S--A--E--D--P--E--K--S--E--S--H--V--I--Q--D-
AGAGGCCATGGCAATGGGCAAACTGCACAAAGAAATGGGTCAGCTAATTGTTCAGTCTGCAGAAGATCCAGAGAAATCAGAGAGCCACGTTATACAGGAT
:   ::::::.::::::::::::::::.:::::::: ::::::.:::::::.::::: ::::::::::::::::::::::: ::::: ::::::::::::
A---GCCATGACAATGGGCAAACTGCATAAAGAAATCGGTCAGTTAATTGTCCAGTCGGCAGAAGATCCAGAGAAATCAGACAGCCAAGTTATACAGGAT
-----A--M--T--M--G--K--L--H--K--E--I--G--Q--L--I--V--Q--S--A--E--D--P--E--K--S--D--S--Q--V--I--Q--D-

----------------------------------------------------------------------------------------------------
-I--A--L--K--T--R--E--I--F--T--N--L--A--P--F--S--E--V--S--A--D--G--E--K--R--V--L--N--L--E--A--L--K--
ATTGCTCTAAAAACAAGAGAAATCTTTACCAACCTAGCACCGTTTTCAGAAGTTTCGGCTGATGGAGAAAAGAGAGTCCTTAATTTGGAGGCGCTAAAGC
::: :.::::::::::.:::::::::.::::::.:.:: ::.::::::::::::::.: ::::::::::::. :::: ::.::::  ::::: :::::::
ATTTCCCTAAAAACAAAAGAAATCTTCACCAACTTGGCTCCATTTTCAGAAGTTTCAGATGATGGAGAAAAACGAGTGCTCAATTACGAGGCCCTAAAGC
-I--S--L--K--T--K--E--I--F--T--N--L--A--P--F--S--E--V--S--D--D--G--E--K--R--V--L--N--Y--E--A--L--K--

------------------------------------------------------------------------->
Q--K--R--F--P--P--A--T--E--N--F--L--Y--H--L--A--A--A--E--Q--M--L--K--I--*-
AAAAACGATTTCCACCAGCAACAGAAAACTTCCTTTATCATCTAGCAGCAGCCGAACAAATGCTGAAAATCTGA
:::..::::::::::::::::::::::::::::: ::.::::::::::: :: :::::::::::::::::::.:
AAAGGCGATTTCCACCAGCAACAGAAAACTTCCTGTACCATCTAGCAGCCGCGGAACAAATGCTGAAAATCTAA
Q--R--R--F--P--P--A--T--E--N--F--L--Y--H--L--A--A--A--E--Q--M--L--K--I--*-

Pig Consensus Sequence

>BGISUST0000896779
---------------------------------------------------------AAGGACACAAATGGAGAAGTTCTGTGGGTGTGGTGTTATCCTT
CCACGACAGCTACTTTAAGGAATCTGCTGCTGCGAAAATGCTGCCTTACAGATGAAAACAGACTTCTCCATCCCTTTGTCTATGGTCAGTACAGAAGAAC
CTGGTTTTATATCACAACAGTGGAAGTGCCAGATGCTTCCGTTTTGAAAAAGGTGACTCATTTTTCTATTGTTCTGACCGCCAAAGATTTTAATCCAGAG
AAATATGCCGCCTTCACTAGGATATTGTGT---ATGTACCTGAAACACGGGAGCCCAGTTAAAATGATGGAGAGTTACATCGCTGTTCTCACGAAGGGGA
TTTGCCAAAGTGAAGAAAATGGCTCTTTCCTTAGCAAGGACTTTGATGCCCGAAAAGCATACCTTGCAGGCTCCATCAAA---ATTGTATCTCAGTTTGG
AATGGAAACTGTTATCTTACACACAGCACTGATGCTAAAGAAAAGGATTGTCGTCTATCACCCCAAAATAGAAGCTGTCCAGGAGTTTACC---ACTCTC
CCTGCCCTGGTGTGGCATCGACAGGACTGGACCATCCTTCACTCCTATGTGCACCTGGACGCCGATGAGCTGGAAGCCCTGCAGATGTGT------TACG
TCGCTGGCTTTGTCGACTTGGAGGTGAGCAATAGATCAGACCTGTACGATGTGTTTGTGAATCTGGCAGATAGTGAGATTACCATTGCTCCGCTCGCAAA
A---GCCATGACAATGGGCAAACTGCATAAAGAAATCGGTCAGTTAATTGTCCAGTCGGCAGAAGATCCAGAGAAATCAGACAGCCAAGTTATACAGGAT
ATTTCCCTAAAAACAAAAGAAATCTTCACCAACTTGGCTCCATTTTCAGAAGTTTCAGATGATGGAGAAAAACGAGTGCTCAATTACGAGGCCCTAAAGC
AAAGGCGATTTCCACCAGCAACAGAAAACTTCCTGTACCATCTAGCAGCCGCGGAACAAATGCTGAAAATCTAA


>BGISUSP0000896779
-------------------KDTNGEVLWVWCYPSTTATLRNLLLRKCCLTDENRLLHPFVYGQYRRTWFYITTVEVPDASVLKKVTHFSIVLTAKDFNPE
KYAAFTRILC-MYLKHGSPVKMMESYIAVLTKGICQSEENGSFLSKDFDARKAYLAGSIK-IVSQFGMETVILHTALMLKKRIVVYHPKIEAVQEFT-TL
PALVWHRQDWTILHSYVHLDADELEALQMC--YVAGFVDLEVSNRSDLYDVFVNLADSEITIAPLAK-AMTMGKLHKEIGQLIVQSAEDPEKSDSQVIQD
ISLKTKEIFTNLAPFSEVSDDGEKRVLNYEALKQRRFPPATENFLYHLAAAEQMLKI*