Sequences
EST Library Info
eje1Foetus 50 days, jejunum
pigca1Unavailable
Clusters
Oligos
SNPs

Gene ID ENSG00000198827 (click for geneview)
Transcript ID ENST00000361461(link to ensembl)
Symbol XP_370697.1
Localtion Chromosome:12:67233042:67233929:-1 band: 12q15
Description PREDICTED: similar to 40S ribosomal protein SA (p40) (34/67 kDa laminin receptor) (Colon carcinoma laminin-binding protein) (NEM/1CHD4) (Multidrug resistance-associated protein MGr1-Ag)
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--S--G--A--L--D--V--L--Q--M--R--E--E--D--V--L--K--F--L--A--A--G--T--H--L--G--G--T--N--L--D--F--Q--
ATGTCCGGAGCCCTTGATGTCCTGCAAATGAGGGAGGAGGATGTCCTTAAGTTCCTTGCAGCAGGAACCCACTTAGGTGGCACCAATCTTGACTTCCAGA
::::::::::::::.::::::::.:::::::..::::::::::::::.::::::::::::::::::::::::.: :::::::::::.:::::::: ::.:
ATGTCCGGAGCCCTCGATGTCCTACAAATGAAAGAGGAGGATGTCCTCAAGTTCCTTGCAGCAGGAACCCACCTTGGTGGCACCAACCTTGACTT-CAAA
-M--S--G--A--L--D--V--L--Q--M--K--E--E--D--V--L--K--F--L--A--A--G--T--H--L--G--G--T--N--L--D--F--Q--

----------------------------------------------------------------------------------------------------
M--E--Q--Y--I--Y--E--R--K--S--D--G--I--Y--I--I--N--L--K--R--T--W--E--K--L--L--L--A--A--H--A--I--V--A
TGGAACAGTACATCTATGAAAGGAAAAGTGATGGCATCTATATCATAAATCTGAAGAGGACCTGGGAGAAGCTTCTGCTGGCAGCTCATGCTATTGTTGC
::::::::::::::::..::::::::::::::::::::::.:::::::::::::::::.:::::::::::.::::::.::::.::::.:::.::.:::::
TGGAACAGTACATCTACAAAAGGAAAAGTGATGGCATCTACATCATAAATCTGAAGAGAACCTGGGAGAAACTTCTGTTGGCGGCTCGTGCCATCGTTGC
M--E--Q--Y--I--Y--K--R--K--S--D--G--I--Y--I--I--N--L--K--R--T--W--E--K--L--L--L--A--A--R--A--I--V--A

----------------------------------------------------------------------------------------------------
--I--E--N--P--A--D--V--S--V--I--S--S--R--N--T--G--Q--T--A--V--L--K--F--A--A--A--T--G--A--T--P--I--A-
CATTGAAAACCCTGCTGATGTCAGTGTTATATCCTCCAGGAATACTGGCCAGACGGCTGTGCTGAAGTTTGCTGCTGCCACTGGAGCCACTCCAATTGCT
:::::::::::: ::.:::::::::::.::::::::::::::::::::::::  .:::::::::::::::::::::::::::::::::::::: ::::::
CATTGAAAACCCAGCCGATGTCAGTGTCATATCCTCCAGGAATACTGGCCAGCGAGCTGTGCTGAAGTTTGCTGCTGCCACTGGAGCCACTCCTATTGCT
--I--E--N--P--A--D--V--S--V--I--S--S--R--N--T--G--Q--R--A--V--L--K--F--A--A--A--T--G--A--T--P--I--A-

----------------------------------------------------------------------------------------------------
-G--R--F--T--P--G--T--F--T--N--Q--I--Q--A--A--F--R--E--P--R--L--L--V--V--T--D--P--R--A--D--H--Q--P--
GGGCGCTTCACTCCTGGAACCTTCACTAACCAGATCCAGGCAGCCTTCCGGGAGCCACGGCTTCTTGTGGTTACTGACCCCAGGGCTGACCACCAGCCTC
:: :::::::::::::::::::::::::::::::::::::::::::::::::::::: :.::::: :::::::::::.::::::::::::::::::::::
GGCCGCTTCACTCCTGGAACCTTCACTAACCAGATCCAGGCAGCCTTCCGGGAGCCAAGACTTCTGGTGGTTACTGATCCCAGGGCTGACCACCAGCCTC
-G--R--F--T--P--G--T--F--T--N--Q--I--Q--A--A--F--R--E--P--R--L--L--V--V--T--D--P--R--A--D--H--Q--P--

----------------------------------------------------------------------------------------------------
L--T--E--A--S--Y--V--N--L--P--T--I--A--L--C--N--T--D--S--P--L--R--Y--V--D--I--A--I--P--C--N--N--K--G
TCACGGAGGCATCTTATGTTAACCTACCTACCATTGCGCTGTGTAACACAGATTCTCCTCTGCGCTATGTGGACATTGCCATCCCATGCAACAACAAGGG
::::.::::: ::::::::::::::.::::::::::: ::::::::::::::.:: ::::::::. :::::::::::::::::::.::::::::::::::
TCACAGAGGCCTCTTATGTTAACCTGCCTACCATTGCTCTGTGTAACACAGACTCACCTCTGCGTAATGTGGACATTGCCATCCCGTGCAACAACAAGGG
L--T--E--A--S--Y--V--N--L--P--T--I--A--L--C--N--T--D--S--P--L--R--N--V--D--I--A--I--P--C--N--N--K--G

----------------------------------------------------------------------------------------------------
--A--Y--S--V--G--L--M--W--W--M--L--A--R--E--V--L--C--M--L--G--T--I--S--C--E--H--P--W--E--V--M--P--D-
AGCTTACTCAGTGGGTTTGATGTGGTGGATGCTGGCTCGGGAAGTTCTGTGCATGCTTGGCACCATTTCCTGTGAACACCCATGGGAGGTCATGCCTGAT
::::.:::::::::::.:::::::::::::::: ::.:::                                                            
AGCTCACTCAGTGGGTCTGATGTGGTGGATGCTCGCCCGG------------------------------------------------------------
--A--H--S--V--G--L--M--W--W--M--L--A--R-------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-L--Y--F--Y--R--D--P--E--E--I--E--K--E--E--Q--A--A--A--E--K--A--V--T--K--E--E--F--Q--G--E--W--T--A--
CTGTACTTCTACAGAGATCCTGAAGAGATTGAAAAAGAAGAGCAGGCTGCTGCTGAAAAGGCAGTGACCAAGGAGGAATTTCAGGGTGAATGGACTGCTC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
P--A--P--E--F--T--A--I--Q--P--E--V--A--D--W--S--E--G--V--Q--V--P--S--V--P--I--Q--Q--F--P--T--E--D--W
CAGCTCCTGAGTTCACTGCTATTCAGCCTGAGGTTGCAGACTGGTCTGAAGGTGTACAGGTGCCCTCTGTGCCTATTCAGCAATTCCCTACTGAAGACTG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------
--S--S--Q--P--A--M--E--D--W--S--A--A--P--T--A--Q--A--T--E--W--V--G--A--T--T--D--W--S--*-
GAGCTCTCAGCCTGCCATGGAAGACTGGTCTGCAGCTCCCACTGCTCAGGCCACTGAATGGGTAGGAGCAACCACTGACTGGTCTTAA
                                                                                        
----------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------

Pig Consensus Sequence

>BGISUST0000891787
ATGTCCGGAGCCCTCGATGTCCTACAAATGAAAGAGGAGGATGTCCTCAAGTTCCTTGCAGCAGGAACCCACCTTGGTGGCACCAACCTTGAccAAATGG
AACAGTACATCTACAAAAGGAAAAGTGATGGCATCTACATCATAAATCTGAAGAGAACCTGGGAGAAACTTCTGTTGGCGGCTCGTGCCATCGTTGCCAT
TGAAAACCCAGCCGATGTCAGTGTCATATCCTCCAGGAATACTGGCCAGCGAGCTGTGCTGAAGTTTGCTGCTGCCACTGGAGCCACTCCTATTGCTGGC
CGCTTCACTCCTGGAACCTTCACTAACCAGATCCAGGCAGCCTTCCGGGAGCCAAGACTTCTGGTGGTTACTGATCCCAGGGCTGACCACCAGCCTCTCA
CAGAGGCCTCTTATGTTAACCTGCCTACCATTGCTCTGTGTAACACAGACTCACCTCTGCGTAATGTGGACATTGCCATCCCGTGCAACAACAAGGGAGC
TCACTCAGTGGGTCTGATGTGGTGGATGCTCGCCCGG---------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
-------------------------------------------------------------------------------------


>BGISUSP0000891787
MSGALDVLQMKEEDVLKFLAAGTHLGGTNLDQMEQYIYKRKSDGIYIINLKRTWEKLLLAARAIVAIENPADVSVISSRNTGQRAVLKFAAATGATPIAG
RFTPGTFTNQIQAAFREPRLLVVTDPRADHQPLTEASYVNLPTIALCNTDSPLRNVDIAIPCNNKGAHSVGLMWWMLAR---------------------
-----------------------------------------------------------------------------------------------