Sequences
EST Library Info
Clusters
Oligos
SNPs

Gene ID ENSG00000198807 (click for geneview)
Transcript ID ENST00000361487(link to ensembl)
Symbol PAX9
Localtion Chromosome:14:36200857:36215837:1 band: 14q13.3
Description Paired box protein Pax-9. [Source:Uniprot/SWISSPROT;Acc:P55771]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<--><-----------------------------------------------------------------------------------------------
-M--E--P--A--F--G--E--V--N--Q--L--G--G--V--F--V--N--G--R--P--L--P--N--A--I--R--L--R--I--V--E--L--A--
ATGGAGCCAGCCTTCGGGGAGGTGAACCAGCTGGGAGGAGTGTTCGTGAACGGGAGGCCGCTGCCCAACGCCATCCGGCTTCGCATCGTGGAACTGGCCC
      ::::::::.::::::::::::::::: ::::::::.:::::::::::::::::::::::::::::::::::::::::::: :::::::::::::
------CCAGCCTTTGGGGAGGTGAACCAGCTCGGAGGAGTATTCGTGAACGGGAGGCCGCTGCCCAACGCCATCCGGCTTCGCATAGTGGAACTGGCCC
-------P--A--F--G--E--V--N--Q--L--G--G--V--F--V--N--G--R--P--L--P--N--A--I--R--L--R--I--V--E--L--A--

----------------------------------------------------------------------------------------------------
Q--L--G--I--R--P--C--D--I--S--R--Q--L--R--V--S--H--G--C--V--S--K--I--L--A--R--Y--N--E--T--G--S--I--L
AACTGGGCATCCGACCGTGTGACATCAGCCGCCAGCTACGGGTCTCGCACGGCTGCGTCAGCAAGATCCTGGCGCGATACAACGAGACGGGCTCGATCTT
::::::::::: ::::.::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: :::::.:::::.:::::.:::::
AACTGGGCATCAGACCATGTGACATCAGCCGCCAGCTACGGGTCTCGCACGGCTGCGTCAGCAAGATCCTGGCGCGCTACAATGAGACAGGCTCAATCTT
Q--L--G--I--R--P--C--D--I--S--R--Q--L--R--V--S--H--G--C--V--S--K--I--L--A--R--Y--N--E--T--G--S--I--L

----------------------------------------------------------------------------------------------------
--P--G--A--I--G--G--S--K--P--R--V--T--T--P--T--V--V--K--H--I--R--T--Y--K--Q--R--D--P--G--I--F--A--W-
GCCAGGAGCCATCGGGGGCAGCAAGCCCCGGGTCACTACCCCCACCGTGGTGAAACACATCCGGACCTACAAGCAGAGAGACCCCGGCATCTTCGCCTGG
::::::::::::::::::.::::::::.::::::::.:::::::::::::::::.:::::::::::::::::::::::.::.::::::::::::::::::
GCCAGGAGCCATCGGGGGTAGCAAGCCTCGGGTCACCACCCCCACCGTGGTGAAGCACATCCGGACCTACAAGCAGAGGGATCCCGGCATCTTCGCCTGG
--P--G--A--I--G--G--S--K--P--R--V--T--T--P--T--V--V--K--H--I--R--T--Y--K--Q--R--D--P--G--I--F--A--W-

----------------------------------------------------------------------------------------------------
-E--I--R--D--R--L--L--A--D--G--V--C--D--K--Y--N--V--P--S--V--S--S--I--S--R--I--L--R--N--K--I--G--N--
GAGATCCGGGACCGCCTGCTGGCGGACGGCGTGTGCGACAAGTACAATGTGCCCTCCGTGAGCTCCATCAGCCGCATTCTGCGCAACAAGATCGGCAACT
::.:: ::::::::::::::::::::.:: :::::.:::::::::::::::::::: ::::::::::::::::::::.::::::::::::::::::::::
GAAATACGGGACCGCCTGCTGGCGGATGGAGTGTGTGACAAGTACAATGTGCCCTCGGTGAGCTCCATCAGCCGCATCCTGCGCAACAAGATCGGCAACT
-E--I--R--D--R--L--L--A--D--G--V--C--D--K--Y--N--V--P--S--V--S--S--I--S--R--I--L--R--N--K--I--G--N--

----------------------------------------------------------------------------------------------------
L--A--Q--Q--G--H--Y--D--S--Y--K--Q--H--Q--P--T--P--Q--P--A--L--P--Y--N--H--I--Y--S--Y--P--S--P--I--T
TGGCCCAGCAGGGTCATTACGACTCATACAAGCAGCACCAGCCGACGCCGCAGCCAGCGCTGCCCTACAACCACATCTACTCGTACCCCAGCCCTATCAC
:::::::.:::::.:::::::::::::::::.::::::::::::.:.::::::::.:::::::::::.:::::::::::.::::::::::::::.::. :
TGGCCCAACAGGGCCATTACGACTCATACAAACAGCACCAGCCGGCACCGCAGCCGGCGCTGCCCTATAACCACATCTATTCGTACCCCAGCCCCATTTC
L--A--Q--Q--G--H--Y--D--S--Y--K--Q--H--Q--P--A--P--Q--P--A--L--P--Y--N--H--I--Y--S--Y--P--S--P--I--S

----------------------------------------------------------------------------------------------------
--A--A--A--A--K--V--P--T--P--P--G--V--P--A--I--P--G--S--V--A--M--P--R--T--W--P--S--S--H--S--V--T--D-
GGCGGCGGCCGCCAAGGTGCCCACGCCACCCGGGGTGCCTGCCATCCCCGGTTCGGTGGCCATGCCGCGCACCTGGCCCTCCTCGCACTCCGTCACCGAC
.   ::::::::.::::::::::: ::.:::::::::::.:::::::: :: ::.::::::::::::::::::::::::::::: :::::::::::::::
A---GCGGCCGCTAAGGTGCCCACTCCGCCCGGGGTGCCCGCCATCCCAGGGTCAGTGGCCATGCCGCGCACCTGGCCCTCCTCCCACTCCGTCACCGAC
-----A--A--A--K--V--P--T--P--P--G--V--P--A--I--P--G--S--V--A--M--P--R--T--W--P--S--S--H--S--V--T--D-

------------------------------><--------------------------------------------------------------------
-I--L--G--I--R--S--I--T--D--Q--V--S--D--S--S--P--Y--H--S--P--K--V--E--E--W--S--S--L--G--R--N--N--F--
ATCCTGGGCATCCGCTCCATCACCGACCAAGTGAGCGACAGCTCCCCCTACCACAGCCCCAAGGTGGAGGAGTGGAGCAGCCTGGGCCGCAACAACTTCC
:::::.::.::.::::::::::::::::::                                                                      
ATCCTAGGTATTCGCTCCATCACCGACCAA----------------------------------------------------------------------
-I--L--G--I--R--S--I--T--D--Q-----------------------------------------------------------------------

----------------------------------------------------------------------><----------------------------
P--A--A--A--P--H--A--V--N--G--L--E--K--G--A--L--E--Q--E--A--K--Y--G--Q--A--P--N--G--L--P--A--V--G--S
CCGCCGCCGCCCCGCACGCGGTGAACGGGTTGGAGAAGGGAGCCCTGGAGCAGGAAGCCAAGTACGGTCAGGCACCAAATGGTCTCCCAGCTGTGGGCAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--F--V--S--A--S--S--M--A--P--Y--P--T--P--A--Q--V--S--P--Y--M--T--Y--S--A--A--P--S--G--Y--V--A--G--H-
TTTTGTGTCAGCATCCAGCATGGCTCCTTACCCTACCCCAGCCCAAGTGTCGCCTTACATGACCTACAGTGCTGCTCCTTCTGGTTATGTTGCTGGACAT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-G--W--Q--H--A--G--G--T--S--L--S--P--H--N--C--D--I--P--A--S--L--A--F--K--G--M--Q--A--A--R--E--G--S--
GGGTGGCAACATGCTGGGGGCACCTCATTGTCTCCCCACAACTGTGACATTCCGGCATCGCTGGCGTTCAAGGGAATGCAGGCAGCCAGAGAAGGTAGTC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

------------------------->
H--S--V--T--A--S--A--L--*-
ATTCTGTCACGGCTTCCGCGCTCTGA
                          
--------------------------
--------------------------

Pig Consensus Sequence

>BGISUST0000892396
------CCAGCCTTTGGGGAGGTGAACCAGCTCGGAGGAGTATTCGTGAACGGGAGGCCGCTGCCCAACGCCATCCGGCTTCGCATAGTGGAACTGGCCC
AACTGGGCATCAGACCATGTGACATCAGCCGCCAGCTACGGGTCTCGCACGGCTGCGTCAGCAAGATCCTGGCGCGCTACAATGAGACAGGCTCAATCTT
GCCAGGAGCCATCGGGGGTAGCAAGCCTCGGGTCACCACCCCCACCGTGGTGAAGCACATCCGGACCTACAAGCAGAGGGATCCCGGCATCTTCGCCTGG
GAAATACGGGACCGCCTGCTGGCGGATGGAGTGTGTGACAAGTACAATGTGCCCTCGGTGAGCTCCATCAGCCGCATCCTGCGCAACAAGATCGGCAACT
TGGCCCAACAGGGCCATTACGACTCATACAAACAGCACCAGCCGGCACCGCAGCCGGCGCTGCCCTATAACCACATCTATTCGTACCCCAGCCCCATTTC
AGCGGCCGCTAAGGTGCCCACTCCGCCCGGGGTGCCCGCCATCCCAGGGTCAGTGGCCATGCCGCGCACCTGGCCCTCCTCCCACTCCGTCACCGACATC
CTAGGTATTCGCTCCATCACCGACCAA-------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
-----------------------


>BGISUSP0000892396
--PAFGEVNQLGGVFVNGRPLPNAIRLRIVELAQLGIRPCDISRQLRVSHGCVSKILARYNETGSILPGAIGGSKPRVTTPTVVKHIRTYKQRDPGIFAW
EIRDRLLADGVCDKYNVPSVSSISRILRNKIGNLAQQGHYDSYKQHQPAPQPALPYNHIYSYPSPISAAAKVPTPPGVPAIPGSVAMPRTWPSSHSVTDI
LGIRSITDQ-------------------------------------------------------------------------------------------
-----------------------------------------