Sequences
EST Library Info
ton1Tip of tongue, mucosal membrane
Clusters
Oligos
SNPs

Gene ID ENSG00000198894 (click for geneview)
Transcript ID ENST00000361552(link to ensembl)
Symbol KIAA1737
Localtion Chromosome:14:76634331:76653382:1 band: 14q24.3
Description  
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-T--M--E--R--K--N--P--S--R--E--S--P--R--R--L--S--A--K--V--G--K--G--T--E--M--K--K--V--A--R--Q--L--G--
ACCATGGAGAGGAAAAACCCATCCAGAGAGAGCCCCAGAAGACTCTCTGCCAAAGTAGGCAAAGGCACAGAGATGAAGAAAGTGGCTCGTCAGCTTGGGA
                                                            :::::::::::::::::.:::::: :::::::.::.:: :
------------------------------------------------------------AAAGGCACAGAGATGAAAAAAGTGTCTCGTCAACTCGGCA
-------------------------------------------------------------K--G--T--E--M--K--K--V--S--R--Q--L--G--

--------------------------------------><------------------------------------------------------------
M--A--A--A--E--S--D--K--D--S--G--F--S--D--G--S--S--E--C--L--S--S--A--E--Q--M--E--S--E--D--M--L--S--A
TGGCTGCTGCTGAGTCAGACAAGGACTCTGGCTTTTCAGATGGGAGCTCGGAATGTCTGAGCTCTGCAGAGCAGATGGAGTCCGAGGACATGCTGAGCGC
:::: ::::::::::::::.::::::::::: ::::::   ::::::::.:::::.:::::::: ::::::::::::::::::::::::.:::::.::::
TGGCAGCTGCTGAGTCAGATAAGGACTCTGGATTTTCA---GGGAGCTCAGAATGCCTGAGCTCGGCAGAGCAGATGGAGTCCGAGGACGTGCTGGGCGC
M--A--A--A--E--S--D--K--D--S--G--F--S-----G--S--S--E--C--L--S--S--A--E--Q--M--E--S--E--D--V--L--G--A

----------------------------------------------------------------------------------------------------
--L--G--W--S--R--E--D--R--P--R--Q--N--S--K--T--A--K--N--A--F--P--T--L--S--P--M--V--V--M--K--N--V--L-
CTTAGGCTGGAGCAGAGAAGACAGGCCGAGGCAGAACTCCAAAACTGCAAAGAATGCCTTCCCTACCCTGTCTCCCATGGTCGTCATGAAGAATGTGCTT
:::::::::::::  :::.::: ::::::::: ::.::::::. :::..:. . ::::::::: :: :::::.::::::::.:::::::::::.::::: 
CTTAGGCTGGAGCCCAGAGGACCGGCCGAGGCCGAGCTCCAAGCCTGTGAGCGCTGCCTTCCCGACGCTGTCCCCCATGGTTGTCATGAAGAACGTGCTG
--L--G--W--S--P--E--D--R--P--R--P--S--S--K--P--V--S--A--A--F--P--T--L--S--P--M--V--V--M--K--N--V--L-

--------><------------------------------------------------------------------------------------------
-V--K--Q--G--S--S--S--S--Q--L--Q--S--W--T--V--Q--P--S--F--E--V--I--S--A--Q--P--Q--L--L--F--L--H--P--
GTCAAACAGGGCAGCAGCTCATCCCAGCTCCAGTCGTGGACTGTCCAGCCCTCCTTTGAAGTGATCTCAGCACAGCCACAGCTCTTATTCCTTCATCCAC
::::::::::::.:::::::::: :::::::::::::::::.:::::::::::::::::.::::::::.::::::::.::::::.: :::::.:::::.:
GTCAAACAGGGCGGCAGCTCATCGCAGCTCCAGTCGTGGACCGTCCAGCCCTCCTTTGAGGTGATCTCGGCACAGCCGCAGCTCCTTTTCCTCCATCCGC
-V--K--Q--G--G--S--S--S--Q--L--Q--S--W--T--V--Q--P--S--F--E--V--I--S--A--Q--P--Q--L--L--F--L--H--P--

----------------------------------------------------------------------------------------------------
P--V--P--S--P--V--S--P--C--H--T--G--E--K--K--S--D--S--R--N--Y--L--P--I--L--N--S--Y--T--K--I--A--P--H
CTGTACCATCTCCTGTCAGTCCATGTCACACTGGTGAGAAAAAGTCCGACTCCAGGAACTACTTGCCCATTCTGAATTCTTACACCAAAATAGCCCCACA
:.:::::.:::::::::::.:: .:::::.: :::::..::::::: :::::::::::::::.:::::::::::::::::::::::::::::::::::::
CCGTACCGTCTCCTGTCAGCCCCCGTCACGCGGGTGAAGAAAAGTCGGACTCCAGGAACTACCTGCCCATTCTGAATTCTTACACCAAAATAGCCCCACA
P--V--P--S--P--V--S--P--R--H--A--G--E--E--K--S--D--S--R--N--Y--L--P--I--L--N--S--Y--T--K--I--A--P--H

----------------------------------------------------------------------------------------------------
--P--G--K--R--G--L--S--L--G--P--E--E--K--G--T--S--G--V--Q--K--K--I--C--T--E--R--L--G--P--S--L--S--S-
TCCAGGCAAAAGGGGCCTTTCCCTTGGCCCAGAAGAAAAAGGAACAAGTGGAGTGCAGAAGAAAATCTGTACTGAGAGACTTGGGCCTAGCTTGTCTTCC
.::::::::.:::::::::.::::.:::::.::::: :.::::. ..:.:::.::::::::::.:::::.:: ::::::::.::::: :::.::::.::.
CCCAGGCAAGAGGGGCCTTCCCCTCGGCCCGGAAGACAGAGGAGAGGGCGGAATGCAGAAGAAGATCTGCACGGAGAGACTCGGGCCGAGCCTGTCCTCT
--P--G--K--R--G--L--P--L--G--P--E--D--R--G--E--G--G--M--Q--K--K--I--C--T--E--R--L--G--P--S--L--S--S-

----------------------------------------------------------------------------------------------------
-S--E--P--T--K--A--G--A--V--P--S--S--P--S--T--P--A--P--P--S--A--K--L--A--E--D--S--A--L--Q--G--V--P--
AGTGAGCCAACCAAGGCTGGTGCTGTCCCATCCAGTCCCTCGACGCCAGCACCACCCAGCGCCAAACTTGCCGAGGACTCAGCTCTGCAGGGTGTGCCCT
.:::::::.:::::: ::::.::::: ::.::::: :::.:::: :: :..:: :::::.:::::.::.:::::::::::.:::::.:.:::.:::::::
GGTGAGCCGACCAAGCCTGGCGCTGTGCCGTCCAGGCCCCCGACCCCCGTGCCCCCCAGTGCCAAGCTCGCCGAGGACTCGGCTCTACGGGGCGTGCCCT
-G--E--P--T--K--P--G--A--V--P--S--R--P--P--T--P--V--P--P--S--A--K--L--A--E--D--S--A--L--R--G--V--P--

----------------------------------------------------------------------------------------------------
S--L--V--A--G--G--S--P--Q--T--L--Q--P--V--S--S--S--H--V--A--K--A--P--S--L--T--F--A--S--P--A--S--P--V
CTCTGGTGGCAGGTGGAAGTCCACAGACTCTTCAGCCGGTATCCAGCAGTCACGTGGCTAAAGCTCCCAGTCTGACCTTCGCTTCCCCCGCCAGTCCTGT
:.::::::::.::.::::::::::::::::::::::::::.::::::::.:::::::::::.::.:::::.:::::::::::::::::::::::.:::::
CCCTGGTGGCGGGCGGAAGTCCACAGACTCTTCAGCCGGTGTCCAGCAGCCACGTGGCTAAGGCCCCCAGCCTGACCTTCGCTTCCCCCGCCAGCCCTGT
S--L--V--A--G--G--S--P--Q--T--L--Q--P--V--S--S--S--H--V--A--K--A--P--S--L--T--F--A--S--P--A--S--P--V

----------------------------------------------------------------------------------------------------
--C--A--S--D--S--T--L--H--G--L--E--S--N--S--P--L--S--P--L--S--A--N--Y--S--S--P--L--W--A--A--E--H--L-
CTGCGCATCAGACAGCACTCTCCATGGGTTAGAGAGCAACTCTCCCCTTTCACCACTGTCCGCTAATTATAGCTCACCTTTATGGGCTGCAGAGCACCTC
::::::.::::::::. :::: :::::: :.:::::: ::.: :: :: :: :: ::::: ::.:.:::.::::: :::.:.:::::.::.:::::::::
CTGCGCGTCAGACAGTTCTCTGCATGGGGTGGAGAGCCACCCGCCGCTGTCCCCCCTGTCAGCCAGTTACAGCTCCCCTCTGTGGGCCGCGGAGCACCTC
--C--A--S--D--S--S--L--H--G--V--E--S--H--P--P--L--S--P--L--S--A--S--Y--S--S--P--L--W--A--A--E--H--L-

----------------------------------------------------------------------------------------------------
-C--R--S--P--D--I--F--S--E--Q--R--Q--S--K--H--R--R--F--Q--N--T--L--V--V--L--H--K--S--G--L--L--E--I--
TGCCGCAGCCCAGATATCTTTTCAGAGCAGCGGCAGAGCAAACATAGGCGCTTTCAGAATACCCTAGTAGTCCTACATAAATCTGGTTTGCTGGAGATCA
:::::::::::::::: :::: ::::::::::::::::::::::.::::::::::::::::: :: ::.:::::.::.:..:::::::::::::::::::
TGCCGCAGCCCAGATAGCTTTGCAGAGCAGCGGCAGAGCAAACACAGGCGCTTTCAGAATACACTCGTGGTCCTGCACAGGTCTGGTTTGCTGGAGATCA
-C--R--S--P--D--S--F--A--E--Q--R--Q--S--K--H--R--R--F--Q--N--T--L--V--V--L--H--R--S--G--L--L--E--I--

----------------------------------------------------------------------------------------------------
T--L--K--T--K--E--L--I--R--Q--N--Q--A--T--Q--V--E--L--D--Q--L--K--E--Q--T--Q--L--F--I--E--A--T--K--S
CTTTGAAAACCAAGGAGTTGATTCGTCAGAATCAGGCAACTCAGGTAGAACTAGACCAGCTAAAGGAGCAAACCCAGCTGTTTATAGAAGCCACCAAGAG
:::::::::::::::::::::::::::::::.::::::::::::::.::::::::::::::.::::::::.::::.:::::: .::::.:::.:::::::
CTTTGAAAACCAAGGAGTTGATTCGTCAGAACCAGGCAACTCAGGTGGAACTAGACCAGCTGAAGGAGCAGACCCGGCTGTTGGTAGAGGCCGCCAAGAG
T--L--K--T--K--E--L--I--R--Q--N--Q--A--T--Q--V--E--L--D--Q--L--K--E--Q--T--R--L--L--V--E--A--A--K--S

----------------------------------------------------------------------------------------------------
--R--A--P--Q--A--W--A--K--L--Q--A--S--L--T--P--G--S--S--N--T--G--S--D--L--E--A--F--S--D--H--P--A--I-
CAGGGCCCCTCAGGCTTGGGCCAAGCTGCAGGCATCTTTAACACCTGGGTCCAGTAATACAGGCAGTGACCTAGAAGCATTCTCTGATCACCCAGCCATA
:::::::::::::::::::::::::::::::::::::::::...: .:::: .:: ::.: :::::..::::::: ...::::::::::: :::: .:::
CAGGGCCCCTCAGGCTTGGGCCAAGCTGCAGGCATCTTTAATGTCAAGGTCAGGTCATGCTGGCAGCAACCTAGACATGTTCTCTGATCAGCCAGATATA
--R--A--P--Q--A--W--A--K--L--Q--A--S--L--M--S--R--S--G--H--A--G--S--N--L--D--M--F--S--D--Q--P--D--I-

-->
-*-
TAG
   
---
---

Pig Consensus Sequence

>BGISUST0000895282
------------------------------------------------------------AAAGGCACAGAGATGAAAAAAGTGTCTCGTCAACTCGGCA
TGGCAGCTGCTGAGTCAGATAAGGACTCTGGATTTTCA---GGGAGCTCAGAATGCCTGAGCTCGGCAGAGCAGATGGAGTCCGAGGACGTGCTGGGCGC
CTTAGGCTGGAGCCCAGAGGACCGGCCGAGGCCGAGCTCCAAGCCTGTGAGCGCTGCCTTCCCGACGCTGTCCCCCATGGTTGTCATGAAGAACGTGCTG
GTCAAACAGGGCGGCAGCTCATCGCAGCTCCAGTCGTGGACCGTCCAGCCCTCCTTTGAGGTGATCTCGGCACAGCCGCAGCTCCTTTTCCTCCATCCGC
CCGTACCGTCTCCTGTCAGCCCCCGTCACGCGGGTGAAGAAAAGTCGGACTCCAGGAACTACCTGCCCATTCTGAATTCTTACACCAAAATAGCCCCACA
CCCAGGCAAGAGGGGCCTTCCCCTCGGCCCGGAAGACAGAGGAGAGGGCGGAATGCAGAAGAAGATCTGCACGGAGAGACTCGGGCCGAGCCTGTCCTCT
GGTGAGCCGACCAAGCCTGGCGCTGTGCCGTCCAGGCCCCCGACCCCCGTGCCCCCCAGTGCCAAGCTCGCCGAGGACTCGGCTCTACGGGGCGTGCCCT
CCCTGGTGGCGGGCGGAAGTCCACAGACTCTTCAGCCGGTGTCCAGCAGCCACGTGGCTAAGGCCCCCAGCCTGACCTTCGCTTCCCCCGCCAGCCCTGT
CTGCGCGTCAGACAGTTCTCTGCATGGGGTGGAGAGCCACCCGCCGCTGTCCCCCCTGTCAGCCAGTTACAGCTCCCCTCTGTGGGCCGCGGAGCACCTC
TGCCGCAGCCCAGATAGCTTTGCAGAGCAGCGGCAGAGCAAACACAGGCGCTTTCAGAATACACTCGTGGTCCTGCACAGGTCTGGTTTGCTGGAGATCA
CTTTGAAAACCAAGGAGTTGATTCGTCAGAACCAGGCAACTCAGGTGGAACTAGACCAGCTGAAGGAGCAGACCCGGCTGTTGGTAGAGGCCGCCAAGAG
CAGGGCCCCTCAGGCTTGGGCCAAGCTGCAGGCATCTTTAATGTCAAGGTCAGGTCATGCTGGCAGCAACCTAGACATGTTCTCTGATCAGCCAGATATA
---


>BGISUSP0000895282
--------------------KGTEMKKVSRQLGMAAAESDKDSGFS-GSSECLSSAEQMESEDVLGALGWSPEDRPRPSSKPVSAAFPTLSPMVVMKNVL
VKQGGSSSQLQSWTVQPSFEVISAQPQLLFLHPPVPSPVSPRHAGEEKSDSRNYLPILNSYTKIAPHPGKRGLPLGPEDRGEGGMQKKICTERLGPSLSS
GEPTKPGAVPSRPPTPVPPSAKLAEDSALRGVPSLVAGGSPQTLQPVSSSHVAKAPSLTFASPASPVCASDSSLHGVESHPPLSPLSASYSSPLWAAEHL
CRSPDSFAEQRQSKHRRFQNTLVVLHRSGLLEITLKTKELIRQNQATQVELDQLKEQTRLLVEAAKSRAPQAWAKLQASLMSRSGHAGSNLDMFSDQPDI
-