Sequences
EST Library Info
che1Heart - RNA from China
cst1Stomach - RNA from China
cut3Uterus - RNA from China
dbla2Unavailable
eep1Foetus 50 days, epidermis
eje2Foetus 50 days, jejunum
gul2Gullet
nco1Newborn 115 days, colon
nep1Newborn 115 days, epidermis
nlu1Newborn 115 days, lung
spl1Spleen
Clusters
Oligos
SNPs

Gene ID ENSG00000122786 (click for geneview)
Transcript ID ENST00000361675(link to ensembl)
Symbol CALD1
Localtion Chromosome:7:133921426:134112725:1 band: 7q33
Description Caldesmon (CDM). [Source:Uniprot/SWISSPROT;Acc:Q05682]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------><----------------------------
-M--D--D--F--E--R--R--R--E--L--R--R--Q--K--R--E--E--M--R--L--E--A--E--R--I--A--Y--Q--R--N--D--D--D--
ATGGATGATTTTGAGCGTCGCAGAGAACTTAGAAGGCAAAAGAGGGAGGAGATGCGACTCGAAGCAGAAAGAATCGCCTACCAGAGGAATGACGATGATG
:::::.::: ::::.:::::::::::::::::.::.:::::: ::::::::::::: :: :::::::::   :::::::::::::::::.::::::::::
ATGGACGATGTTGAACGTCGCAGAGAACTTAGGAGACAAAAGCGGGAGGAGATGCGCCTGGAAGCAGAA---ATCGCCTACCAGAGGAACGACGATGATG
-M--D--D--V--E--R--R--R--E--L--R--R--Q--K--R--E--E--M--R--L--E--A--E-----I--A--Y--Q--R--N--D--D--D--

----------------------------------------------------------------------------------------------------
E--E--E--A--A--R--E--R--R--R--R--A--R--Q--E--R--L--R--Q--K--Q--E--E--E--S--L--G--Q--V--T--D--Q--V--E
AAGAGGAGGCAGCCCGGGAACGGCGCCGCCGAGCCCGACAGGAACGGCTGCGGCAGAAGCAGGAGGAAGAATCCTTGGGACAGGTGACCGACCAGGTGGA
:.::.::::: :::::::::::::::::::: :::::.:::::: ::::::::::::::::.:::::::::::::::::.::::::::::::::::::::
AGGAAGAGGCCGCCCGGGAACGGCGCCGCCGCGCCCGGCAGGAAAGGCTGCGGCAGAAGCAAGAGGAAGAATCCTTGGGGCAGGTGACCGACCAGGTGGA
E--E--E--A--A--R--E--R--R--R--R--A--R--Q--E--R--L--R--Q--K--Q--E--E--E--S--L--G--Q--V--T--D--Q--V--E

-----------------><---------------------------------------------------------------------------------
--V--N--A--Q--N--S--V--P--D--E--E--A--K--T--T--T--T--N--T--Q--V--E--G--D--D--E--A--A--F--L--E--R--L-
GGTGAATGCCCAGAACAGTGTGCCTGACGAGGAGGCCAAGACAACCACCACAAACACTCAAGTGGAAGGGGATGATGAGGCCGCATTCCTGGAGCGCCTG
::: :::.::::::::   :::::.::.::: :::.:::::::::::::::.::::::::..::::.:  ::::::::.::.:::.:.::::::::::::
GGTCAATACCCAGAAC---GTGCCCGATGAGCAGGTCAAGACAACCACCACGAACACTCAGATGGAGGCCGATGATGAAGCTGCACTTCTGGAGCGCCTG
--V--N--T--Q--N-----V--P--D--E--Q--V--K--T--T--T--T--N--T--Q--M--E--A--D--D--E--A--A--L--L--E--R--L-

----------------------------------------------------------------------------------------------------
-A--R--R--E--E--R--R--Q--K--R--L--Q--E--A--L--E--R--Q--K--E--F--D--P--T--I--T--D--A--S--L--S--L--P--
GCTCGGCGTGAGGAAAGACGCCAAAAACGCCTTCAGGAGGCTCTGGAGCGGCAGAAGGAGTTCGACCCAACAATAACAGATGCAAGTCTGTCGCTCCCAA
:::::::: :::::::::::::::::::::::::::::.::.::::::::::::::::::::.::.::::: :::.:::::::::::..:::::. ::::
GCTCGGCGGGAGGAAAGACGCCAAAAACGCCTTCAGGAAGCCCTGGAGCGGCAGAAGGAGTTTGATCCAACCATAGCAGATGCAAGTTCGTCGCCACCAA
-A--R--R--E--E--R--R--Q--K--R--L--Q--E--A--L--E--R--Q--K--E--F--D--P--T--I--A--D--A--S--S--S--P--P--

----------------------------------------------------------------------------------------------------
S--R--R--M--Q--N--D--T--A--E--N--E--T--T--E--K--E--E--K--S--E--S--R--Q--E--R--Y--E--I--E--E--T--E--T
GCAGAAGAATGCAAAATGACACAGCAGAAAATGAAACTACCGAGAAGGAAGAAAAAAGTGAAAGTCGCCAAGAAAGATACGAGATAGAGGAAACAGAAAC
:::::::::::::.:::..::::::::::.::::.:: .: :::::::: ::.::::::::::::::::::::::::::::::::::::::.::::::..
GCAGAAGAATGCAGAATAGCACAGCAGAAGATGAGACGGCGGAGAAGGATGAGAAAAGTGAAAGTCGCCAAGAAAGATACGAGATAGAGGAGACAGAAGT
S--R--R--M--Q--N--S--T--A--E--D--E--T--A--E--K--D--E--K--S--E--S--R--Q--E--R--Y--E--I--E--E--T--E--V

----------------------------------------------------------------------------------------------------
--V--T--K--S--Y--Q--K--N--D--W--R--D--A--E--E--N--K--K--E--D--K--E--K--E--E--E--E--E--E--K--P--K--R-
AGTCACCAAGTCCTACCAGAAGAATGATTGGAGGGATGCTGAAGAAAACAAGAAAGAAGACAAGGAAAAGGAGGAGGAGGAAGAGGAGAAGCCAAAGCGA
:::::::::::::::::::::::::::::::::.:::::.:::::. : :::::.::::: ::.:::::::::::.::::::::.::::::::::: :.:
AGTCACCAAGTCCTACCAGAAGAATGATTGGAGAGATGCCGAAGAGCAAAAGAAGGAAGAAAAAGAAAAGGAGGAAGAGGAAGAAGAGAAGCCAAACCAA
--V--T--K--S--Y--Q--K--N--D--W--R--D--A--E--E--Q--K--K--E--E--K--E--K--E--E--E--E--E--E--K--P--N--Q-

----------------------------------------------------------------------------------------------------
-G--S--I--G--E--N--Q--V--E--V--M--V--E--E--K--T--T--E--S--Q--E--E--T--V--V--M--S--L--K--N--G--Q--I--
GGGAGCATTGGAGAAAATCAGGTAGAGGTGATGGTGGAAGAGAAAACAACTGAAAGCCAGGAGGAAACAGTGGTAATGTCATTAAAAAATGGGCAGATCA
::::::::::.:::.::::::::::::.::.::::.::::::::::::.: :::: :::.:::::::::   : :::: ::::.:::::::::::.::::
GGGAGCATTGAAGAGAATCAGGTAGAGATGGTGGTAGAAGAGAAAACAGCAGAAACCCAAGAGGAAACA---GGAATGGCATTGAAAAATGGGCAAATCA
-G--S--I--E--E--N--Q--V--E--M--V--V--E--E--K--T--A--E--T--Q--E--E--T-----G--M--A--L--K--N--G--Q--I--

----------------------------------------------------------------------------------------------------
S--S--E--E--P--K--Q--E--E--E--R--E--Q--G--S--D--E--I--S--H--H--E--K--M--E--E--E--D--K--E--R--A--E--A
GTTCAGAAGAGCCTAAACAAGAGGAGGAGAGGGAACAAGGTTCAGATGAGATTTCCCATCATGAAAAGATGGAAGAGGAAGACAAGGAAAGAGCTGAGGC
:: : :: :::::::..  :::::::::::::::: :::::::: ::::::: .::::: ::::::::::.::::::::::  :.:::::::::::::::
GTGCCGATGAGCCTAGGACAGAGGAGGAGAGGGAAAAAGGTTCACATGAGATGCCCCATAATGAAAAGATAGAAGAGGAAGCAAGGGAAAGAGCTGAGGC
S--A--D--E--P--R--T--E--E--E--R--E--K--G--S--H--E--M--P--H--N--E--K--I--E--E--E--A--R--E--R--A--E--A

----------------------------------------------------------------------------------------------------
--E--R--A--R--L--E--A--E--E--R--E--R--I--K--A--E--Q--D--K--K--I--A--D--E--R--A--R--I--E--A--E--E--K-
AGAGAGGGCAAGGTTGGAAGCAGAAGAAAGAGAAAGAATTAAAGCCGAGCAAGACAAAAAGATAGCAGATGAACGAGCAAGAATTGAAGCAGAAGAAAAA
:::::::::  :::::::::: ::::::::::::::::: ::::::                                                      
AGAGAGGGCCCGGTTGGAAGCCGAAGAAAGAGAAAGAATGAAAGCC------------------------------------------------------
--E--R--A--R--L--E--A--E--E--R--E--R--M--K--A-------------------------------------------------------

----------------------------------------------------------------------------------------------------
-A--A--A--Q--E--R--E--R--R--E--A--E--E--R--E--R--M--R--E--E--E--K--R--A--A--E--E--R--Q--R--I--K--E--
GCAGCTGCCCAAGAAAGAGAAAGGAGAGAGGCAGAAGAGAGGGAAAGGATGAGGGAGGAAGAGAAAAGGGCAGCAGAGGAGAGGCAGAGGATAAAGGAGG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
E--E--K--R--A--A--E--E--R--Q--R--I--K--E--E--E--K--R--A--A--E--E--R--Q--R--I--K--E--E--E--K--R--A--A
AAGAGAAAAGGGCAGCAGAGGAGAGGCAGAGGATAAAGGAGGAAGAGAAAAGGGCAGCAGAGGAGAGGCAGAGGATAAAAGAGGAAGAGAAAAGGGCAGC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--E--E--R--Q--R--A--R--A--E--E--E--E--K--A--K--V--E--E--Q--K--R--N--K--Q--L--E--E--K--K--H--A--M--Q-
AGAGGAGAGGCAAAGGGCCAGGGCAGAGGAGGAAGAGAAGGCTAAGGTAGAAGAGCAGAAACGTAACAAGCAGCTAGAAGAGAAAAAACATGCCATGCAA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-E--T--K--I--K--G--E--K--V--E--Q--K--I--E--G--K--W--V--N--E--K--K--A--Q--E--D--K--L--Q--T--A--V--L--
GAGACAAAGATAAAAGGGGAAAAGGTAGAACAGAAAATAGAAGGGAAATGGGTAAATGAAAAGAAAGCACAAGAAGATAAACTTCAGACAGCTGTCCTAA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-------><----------------------------------------------------------------------------><-------------
K--K--Q--G--E--E--K--G--T--K--V--Q--A--K--R--E--K--L--Q--E--D--K--P--T--F--K--K--E--E--I--K--D--E--K
AGAAACAGGGAGAAGAGAAGGGAACTAAAGTGCAAGCTAAAAGAGAAAAGCTCCAAGAAGACAAGCCTACCTTCAAAAAAGAAGAGATCAAAGATGAAAA
           :::::.:.:::..:::::::::::::::::::::::::::.:::::::::::::::::::::::::::::::::::::::::::::.::
-----------GAAGAAAGGGGGGCTAAAGTGCAAGCTAAAAGAGAAAAGCCCCAAGAAGACAAGCCTACCTTCAAAAAAGAAGAGATCAAAGATGAGAA
------------E--E--R--G--A--K--V--Q--A--K--R--E--K--P--Q--E--D--K--P--T--F--K--K--E--E--I--K--D--E--K

----------------------------------------------------------------------------------------------------
--I--K--K--D--K--E--P--K--E--E--V--K--S--F--M--D--R--K--K--G--F--T--E--V--K--S--Q--N--G--E--F--M--T-
GATTAAAAAGGACAAAGAACCCAAAGAAGAAGTTAAGAGCTTCATGGATCGAAAGAAGGGATTTACAGAAGTTAAGTCGCAGAATGGAGAATTCATGACC
::.::::::::::::::::: :::.:::::::::::::::::: :::.: :::::::::::.::::::: :: ::: :.:::::::::::::::::::::
GACTAAAAAGGACAAAGAACGCAAGGAAGAAGTTAAGAGCTTCTTGGGTGGAAAGAAGGGACTTACAGACGTGAAGGCACAGAATGGAGAATTCATGACC
--T--K--K--D--K--E--R--K--E--E--V--K--S--F--L--G--G--K--K--G--L--T--D--V--K--A--Q--N--G--E--F--M--T-

-------------------------------><-------------------------------------------------------------------
-H--K--L--K--H--T--E--N--T--F--S--R--P--G--G--R--A--S--V--D--T--K--E--A--E--G--A--P--Q--V--E--A--G--
CACAAACTTAAACATACTGAGAATACTTTCAGCCGCCCTGGAGGGAGGGCCAGCGTGGACACCAAGGAGGCTGAGGGCGCCCCCCAGGTGGAAGCCGGCA
:::::.::.:::::.::.:::::::: :::   ::::::::::::::::::::.   :: .::::::::.::::::::::..::::.:::::::: ::::
CACAAGCTCAAACACACCGAGAATACGTTC---CGCCCTGGAGGGAGGGCCAGT---GAGGCCAAGGAGACTGAGGGCGCTTCCCAAGTGGAAGCGGGCA
-H--K--L--K--H--T--E--N--T--F-----R--P--G--G--R--A--S-----E--A--K--E--T--E--G--A--S--Q--V--E--A--G--

----------------------------------------------------------------------------------------------------
K--R--L--E--E--L--R--R--R--R--G--E--T--E--S--E--E--F--E--K--L--K--Q--K--Q--Q--E--A--A--L--E--L--E--E
AAAGGCTGGAGGAGCTTCGTCGTCGTCGCGGGGAGACCGAGAGCGAAGAGTTCGAGAAGCTCAAACAGAAGCAGCAGGAGGCGGCTTTGGAGCTGGAGGA
:. ::::::::::::::::.::.::.:::::::::::::::::.::.:::::::::::::::::.:::::.::::::::::::::.:::::.::::::::
AGCGGCTGGAGGAGCTTCGCCGCCGCCGCGGGGAGACCGAGAGTGAGGAGTTCGAGAAGCTCAAGCAGAAACAGCAGGAGGCGGCCTTGGAACTGGAGGA
K--R--L--E--E--L--R--R--R--R--G--E--T--E--S--E--E--F--E--K--L--K--Q--K--Q--Q--E--A--A--L--E--L--E--E

---------------------------------------------------------------------------------------------><-----
--L--K--K--K--R--E--E--R--R--K--V--L--E--E--E--E--Q--R--R--K--Q--E--E--A--D--R--K--L--R--E--E--E--E-
ACTCAAGAAAAAGAGGGAGGAGAGAAGGAAGGTCCTGGAGGAGGAAGAGCAGAGGAGGAAGCAGGAGGAAGCCGATCGAAAACTCAGAGAGGAGGAAGAG
.:: :::::.:::::::::::: ::::::::::::::::::::::.:::::::::::::::::::::::::: ::                   ::::::
GCTGAAGAAGAAGAGGGAGGAGCGAAGGAAGGTCCTGGAGGAGGAGGAGCAGAGGAGGAAGCAGGAGGAAGCAGAG------------------GAAGAG
--L--K--K--K--R--E--E--R--R--K--V--L--E--E--E--E--Q--R--R--K--Q--E--E--A--E--------------------E--E-

----------------------------------------------------------------------------------------------------
-K--R--R--L--K--E--E--I--E--R--R--R--A--E--A--A--E--K--R--Q--K--M--P--E--D--G--L--S--D--D--K--K--P--
AAGAGGAGGCTAAAGGAAGAGATTGAAAGGCGAAGAGCAGAAGCTGCTGAGAAACGCCAGAAGATGCCAGAAGATGGCTTGTCAGATGACAAGAAACCAT
:::::::::::::::::::::::::::::::::::.:::::::::::::::::::::::::::::::::::::::::.::::::::.::::::::.:: :
AAGAGGAGGCTAAAGGAAGAGATTGAAAGGCGAAGGGCAGAAGCTGCTGAGAAACGCCAGAAGATGCCAGAAGATGGTTTGTCAGACGACAAGAAGCCCT
-K--R--R--L--K--E--E--I--E--R--R--R--A--E--A--A--E--K--R--Q--K--M--P--E--D--G--L--S--D--D--K--K--P--

----------------------------------><------------------------------------------><--------------------
F--K--C--F--T--P--K--G--S--S--L--K--I--E--E--R--A--E--F--L--N--K--S--V--Q--K--S--S--G--V--K--S--T--H
TCAAGTGTTTCACTCCTAAAGGTTCATCTCTCAAGATAGAAGAGCGAGCAGAATTTTTGAATAAGTCTGTGCAGAAAAGCAGTGGTGTCAAATCGACCCA
::::.::::::.::::.::::: ::::::::::::::::::::::::::::::::::::::::::::::::::::::   :::::::::::.::.::.::
TCAAATGTTTCGCTCCCAAAGGGTCATCTCTCAAGATAGAAGAGCGAGCAGAATTTTTGAATAAGTCTGTGCAGAAA---AGTGGTGTCAAGTCAACTCA
F--K--C--F--A--P--K--G--S--S--L--K--I--E--E--R--A--E--F--L--N--K--S--V--Q--K-----S--G--V--K--S--T--H

------------------------------------------------------------><--------------------------------------
--Q--A--A--I--V--S--K--I--D--S--R--L--E--Q--Y--T--S--A--I--E--G--T--K--S--A--K--P--T--K--P--A--A--S-
TCAAGCAGCAATAGTCTCCAAGATTGACAGCAGACTGGAGCAGTATACCAGTGCAATTGAGGGAACAAAAAGCGCAAAACCTACAAAGCCGGCAGCCTCG
::::::::::.:.::::::::::::::::::::.:::::::::::.:::::.:::::::::                                       
TCAAGCAGCAGTGGTCTCCAAGATTGACAGCAGGCTGGAGCAGTACACCAGCGCAATTGAG---------------------------------------
--Q--A--A--V--V--S--K--I--D--S--R--L--E--Q--Y--T--S--A--I--E----------------------------------------

--------------------------------------------------------------------------------------------------><
-D--L--P--V--P--A--E--G--V--R--N--I--K--S--M--W--E--K--G--N--V--F--S--S--P--T--A--A--G--T--P--N--K--
GATCTTCCTGTTCCTGCTGAAGGTGTACGCAACATCAAGAGTATGTGGGAGAAAGGGAATGTGTTTTCATCCCCCACTGCAGCAGGCACACCAAATAAGG
                                                                                                   :
---------------------------------------------------------------------------------------------------G
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------><----
E--T--A--G--L--K--V--G--V--S--S--R--I--N--E--W--L--T--K--T--P--D--G--N--K--S--P--A--P--K--P--S--D--L
AAACTGCTGGCTTGAAGGTAGGGGTTTCTAGCCGCATCAATGAATGGCTAACTAAAACCCCAGATGGAAACAAGTCACCTGCTCCCAAACCTTCTGACTT
:::::::::::::::::::.::::::::.:::::::::::.:::::::::::.::::::::::::: ::::::::::::::::::::::::::::::.::
AAACTGCTGGCTTGAAGGTGGGGGTTTCCAGCCGCATCAACGAATGGCTAACCAAAACCCCAGATGCAAACAAGTCACCTGCTCCCAAACCTTCTGATTT
E--T--A--G--L--K--V--G--V--S--S--R--I--N--E--W--L--T--K--T--P--D--A--N--K--S--P--A--P--K--P--S--D--L

---------------------------------------------------------------------------><---->
--R--P--G--D--V--S--S--K--R--N--L--W--E--K--Q--S--V--D--K--V--T--S--P--T--K--V--*-
GAGACCAGGAGACGTATCCAGCAAGCGGAACCTCTGGGAAAAGCAATCTGTGGATAAGGTCACTTCCCCCACTAAGGTTTGA
:::.::::::::::::::..::::.::.:::::::::::::::::::: :::::.:::::::::::::: ::::::      
GAGGCCAGGAGACGTATCTGGCAAACGAAACCTCTGGGAAAAGCAATCAGTGGACAAGGTCACTTCCCCAACTAAG------
--R--P--G--D--V--S--G--K--R--N--L--W--E--K--Q--S--V--D--K--V--T--S--P--T--K-------

Pig Consensus Sequence

>BGISUST0000896374
ATGGACGATGTTGAACGTCGCAGAGAACTTAGGAGACAAAAGCGGGAGGAGATGCGCCTGGAAGCAGAA---ATCGCCTACCAGAGGAACGACGATGATG
AGGAAGAGGCCGCCCGGGAACGGCGCCGCCGCGCCCGGCAGGAAAGGCTGCGGCAGAAGCAAGAGGAAGAATCCTTGGGGCAGGTGACCGACCAGGTGGA
GGTCAATACCCAGAAC---GTGCCCGATGAGCAGGTCAAGACAACCACCACGAACACTCAGATGGAGGCCGATGATGAAGCTGCACTTCTGGAGCGCCTG
GCTCGGCGGGAGGAAAGACGCCAAAAACGCCTTCAGGAAGCCCTGGAGCGGCAGAAGGAGTTTGATCCAACCATAGCAGATGCAAGTTCGTCGCCACCAA
GCAGAAGAATGCAGAATAGCACAGCAGAAGATGAGACGGCGGAGAAGGATGAGAAAAGTGAAAGTCGCCAAGAAAGATACGAGATAGAGGAGACAGAAGT
AGTCACCAAGTCCTACCAGAAGAATGATTGGAGAGATGCCGAAGAGCAAAAGAAGGAAGAAAAAGAAAAGGAGGAAGAGGAAGAAGAGAAGCCAAACCAA
GGGAGCATTGAAGAGAATCAGGTAGAGATGGTGGTAGAAGAGAAAACAGCAGAAACCCAAGAGGAAACAGGAATGGCATTGAAAAATGGGCAAATCAGTG
CCGATGAGCCTAGGACAGAGGAGGAGAGGGAAAAAGGTTCACATGAGATGCCCCATAATGAAAAGATAGAAGAGGAAGCAAGGGAAAGAGCTGAGGCAGA
GAGGGCCCGGTTGGAAGCCGAAGAAAGAGAAAGAATGAAAGCC---------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
--------GAAGAAAGGGGGGCTAAAGTGCAAGCTAAAAGAGAAAAGCCCCAAGAAGACAAGCCTACCTTCAAAAAAGAAGAGATCAAAGATGAGAAGAC
TAAAAAGGACAAAGAACGCAAGGAAGAAGTTAAGAGCTTCTTGGGTGGAAAGAAGGGACTTACAGACGTGAAGGCACAGAATGGAGAATTCATGACCCAC
AAGCTCAAACACACCGAGAATACGTTC---CGCCCTGGAGGGAGGGCCAGTGAGGCCAAGGAGACTGAGGGCGCTTCCCAAGTGGAAGCGGGCAAGCGGC
TGGAGGAGCTTCGCCGCCGCCGCGGGGAGACCGAGAGTGAGGAGTTCGAGAAGCTCAAGCAGAAACAGCAGGAGGCGGCCTTGGAACTGGAGGAGCTGAA
GAAGAAGAGGGAGGAGCGAAGGAAGGTCCTGGAGGAGGAGGAGCAGAGGAGGAAGCAGGAGGAAGCAGAG------------------GAAGAGAAGAGG
AGGCTAAAGGAAGAGATTGAAAGGCGAAGGGCAGAAGCTGCTGAGAAACGCCAGAAGATGCCAGAAGATGGTTTGTCAGACGACAAGAAGCCCTTCAAAT
GTTTCGCTCCCAAAGGGTCATCTCTCAAGATAGAAGAGCGAGCAGAATTTTTGAATAAGTCTGTGCAGAAA---AGTGGTGTCAAGTCAACTCATCAAGC
AGCAGTGGTCTCCAAGATTGACAGCAGGCTGGAGCAGTACACCAGCGCAATTGAG---------------------------------------------
---------------------------------------------------------------------------------------------GAAACTG
CTGGCTTGAAGGTGGGGGTTTCCAGCCGCATCAACGAATGGCTAACCAAAACCCCAGATGCAAACAAGTCACCTGCTCCCAAACCTTCTGATTTGAGGCC
AGGAGACGTATCTGGCAAACGAAACCTCTGGGAAAAGCAATCAGTGGACAAGGTCACTTCCCCAACTAAG------


>BGISUSP0000896374
MDDVERRRELRRQKREEMRLEAE-IAYQRNDDDEEEAARERRRRARQERLRQKQEEESLGQVTDQVEVNTQN-VPDEQVKTTTTNTQMEADDEAALLERL
ARREERRQKRLQEALERQKEFDPTIADASSSPPSRRMQNSTAEDETAEKDEKSESRQERYEIEETEVVTKSYQKNDWRDAEEQKKEEKEKEEEEEEKPNQ
GSIEENQVEMVVEEKTAETQEETGMALKNGQISADEPRTEEEREKGSHEMPHNEKIEEEARERAEAERARLEAEERERMKA-------------------
----------------------------------------------------------------------------------------------------
------------------------------------EERGAKVQAKREKPQEDKPTFKKEEIKDEKTKKDKERKEEVKSFLGGKKGLTDVKAQNGEFMTH
KLKHTENTF-RPGGRASEAKETEGASQVEAGKRLEELRRRRGETESEEFEKLKQKQQEAALELEELKKKREERRKVLEEEEQRRKQEEAE------EEKR
RLKEEIERRRAEAAEKRQKMPEDGLSDDKKPFKCFAPKGSSLKIEERAEFLNKSVQK-SGVKSTHQAAVVSKIDSRLEQYTSAIE---------------
-------------------------------ETAGLKVGVSSRINEWLTKTPDANKSPAPKPSDLRPGDVSGKRNLWEKQSVDKVTSPTK--