Sequences
EST Library Info
cbe1Cerebellum
eep1Foetus 50 days, epidermis
ese1Foetus 50 days, M. semitendinosus
Clusters
Oligos
SNPs

Gene ID ENSG00000198795 (click for geneview)
Transcript ID ENST00000361811(link to ensembl)
Symbol ZNF521
Localtion Chromosome:18:20895889:21186114:-1 band: 18q11.2
Description zinc finger protein 521 [Source:RefSeq_peptide;Acc:NP_056276]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-F--L--S--D--Y--V--Q--S--E--S--L--R--V--R--G--P--L--W--S--H--P--D--G--F--G--G--L--A--S--I--F--H--Y--
TTCCTCAGTGATTACGTACAGAGCGAGTCCCTGCGGGTTAGGGGCCCCCTCTGGAGCCATCCTGATGGCTTTGGGGGCCTTGCTTCCATTTTCCATTATT
::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
TTCCTCAGTGATTACGTACAGAGCGAGTCCCTGCGGGTTAGGGGCCCCCTCTGGAGCCATCCTGATGGCTTTGGGGGCCTTGCTTCCATTTTCCATTATT
-F--L--S--D--Y--V--Q--S--E--S--L--R--V--R--G--P--L--W--S--H--P--D--G--F--G--G--L--A--S--I--F--H--Y--

-----------------------------------------><---------------------------------------------------------
Y--V--D--Y--R--S--D--S--A--V--Q--D--L--A--D--P--N--C--K--L--E--D--K--T--E--D--G--E--A--L--D--C--K--K
ATGTGGACTACCGGAGCGACAGCGCAGTCCAAGACCTTGCAGACCCCAACTGTAAACTTGAAGACAAGACTGAAGATGGAGAGGCACTAGATTGTAAGAA
:::::::::::::::::::::::::::::::::::::::::                                                           
ATGTGGACTACCGGAGCGACAGCGCAGTCCAAGACCTTGCA-----------------------------------------------------------
Y--V--D--Y--R--S--D--S--A--V--Q--D--L--A------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--R--P--E--D--G--E--E--L--E--D--E--A--V--H--S--C--D--S--C--L--Q--V--F--E--S--L--S--D--I--T--E--H--K-
GAGGCCGGAAGACGGGGAGGAGTTGGAAGACGAAGCTGTGCACAGCTGTGACAGCTGCCTCCAGGTGTTTGAATCGCTGAGCGATATCACAGAACACAAG
       ::::::::.::::::.:.::::.:::::::::::::::::::::::::::::::::::::::.::.::.::::::::::::::::::::::::
-------GAAGACGGAGAGGAGCTAGAAGGCGAAGCTGTGCACAGCTGTGACAGCTGCCTCCAGGTGTTCGAGTCACTGAGCGATATCACAGAACACAAG
--------E--D--G--E--E--L--E--G--E--A--V--H--S--C--D--S--C--L--Q--V--F--E--S--L--S--D--I--T--E--H--K-

---------------------><-----------------------------------------------------------------------------
-I--N--Q--C--Q--L--T--D--G--V--D--V--E--D--D--P--T--C--S--W--P--A--S--S--P--S--S--K--D--Q--T--S--P--
ATTAATCAATGTCAACTGACAGATGGAGTGGATGTTGAAGATGATCCGACTTGCTCTTGGCCAGCTTCCTCACCTTCTAGCAAGGATCAGACTTCCCCTA
::::::::::::::.::::::                                                                               
ATTAATCAATGTCAGCTGACA-------------------------------------------------------------------------------
-I--N--Q--C--Q--L--T--------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
S--H--G--E--G--C--D--F--G--E--E--E--G--G--P--G--L--P--Y--P--C--Q--F--C--D--K--S--F--S--R--L--S--Y--L
GCCATGGAGAAGGTTGCGATTTTGGAGAGGAAGAAGGTGGCCCTGGGCTTCCATACCCGTGTCAATTCTGTGACAAGTCGTTTAGCCGCCTCAGCTACCT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--K--H--H--E--Q--S--H--S--D--K--L--P--F--K--C--T--Y--C--S--R--L--F--K--H--K--R--S--R--D--R--H--I--K-
AAAGCACCATGAGCAGAGTCACAGTGACAAACTGCCTTTCAAATGCACCTACTGCAGTAGGCTGTTCAAACACAAGCGCAGCCGAGATCGCCACATAAAA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-L--H--T--G--D--K--K--Y--H--C--S--E--C--D--A--A--F--S--R--S--D--H--L--K--I--H--L--K--T--H--T--S--N--
CTCCACACCGGGGACAAGAAGTACCACTGCAGTGAATGTGATGCTGCGTTTTCCAGAAGTGATCACTTGAAGATCCACTTAAAGACTCACACGTCCAACA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
K--P--Y--K--C--A--I--C--R--R--G--F--L--S--S--S--S--L--H--G--H--M--Q--V--H--E--R--N--K--D--G--S--Q--S
AGCCATATAAATGTGCCATTTGTCGCCGTGGGTTTCTGTCCTCTAGTTCCTTACACGGACACATGCAGGTTCATGAGAGGAACAAGGACGGCTCTCAGTC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--G--S--R--M--E--D--W--K--M--K--D--T--Q--K--C--S--Q--C--E--E--G--F--D--F--P--E--D--L--Q--K--H--I--A-
CGGTTCCAGGATGGAGGACTGGAAGATGAAGGACACTCAGAAGTGCAGTCAGTGTGAGGAAGGCTTTGACTTCCCGGAAGACCTCCAAAAACACATTGCA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-E--C--H--P--E--C--S--P--N--E--D--R--A--A--L--Q--C--V--Y--C--H--E--L--F--V--E--E--T--S--L--M--N--H--
GAGTGCCACCCCGAATGCTCCCCAAATGAGGACCGAGCGGCCCTCCAGTGTGTCTACTGCCACGAGCTCTTCGTAGAGGAGACCTCCCTCATGAACCACA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
M--E--Q--V--H--S--G--E--K--K--N--S--C--S--I--C--S--E--S--F--H--T--V--E--E--L--Y--S--H--M--D--S--H--Q
TGGAGCAGGTGCATAGCGGGGAGAAGAAGAACTCATGCAGCATTTGTTCTGAGAGTTTCCACACAGTTGAGGAACTGTACAGCCACATGGACAGTCACCA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--Q--P--E--S--C--N--H--S--N--S--P--S--L--V--T--V--G--Y--T--S--V--S--S--T--T--P--D--S--N--L--S--V--D-
GCAACCGGAGTCATGCAATCACAGCAACAGCCCTTCCCTGGTCACGGTGGGCTATACCTCCGTGTCCAGTACGACTCCAGATTCCAACCTCTCAGTGGAC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-S--S--T--M--V--E--A--A--P--P--I--P--K--S--R--G--R--K--R--A--A--Q--Q--T--P--D--M--T--G--P--S--S--K--
AGCTCAACCATGGTGGAAGCTGCCCCGCCAATCCCAAAGAGTCGAGGGAGGAAGAGGGCCGCTCAACAAACCCCTGACATGACTGGTCCCTCGAGTAAAC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
Q--A--K--V--T--Y--S--C--I--Y--C--N--K--Q--L--F--S--S--L--A--V--L--Q--I--H--L--K--T--M--H--L--D--K--P
AAGCAAAAGTTACCTACAGCTGTATTTACTGCAACAAACAATTATTTTCAAGTCTTGCAGTTCTGCAGATTCACCTGAAAACTATGCACTTAGATAAGCC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--E--Q--A--H--I--C--Q--Y--C--L--E--V--L--P--S--L--Y--N--L--N--E--H--L--K--Q--V--H--E--A--Q--D--P--G-
AGAACAGGCCCATATTTGTCAGTATTGCTTGGAGGTCCTGCCCTCACTCTATAACCTAAATGAACATCTTAAGCAAGTGCATGAAGCTCAGGACCCAGGT
 ::.::.:::::.::::::::::::::::::::::: :::::::: ::::::::::: ::.::::::::::::::::::::.::::::::::::::::::
-GAGCAAGCCCACATTTGTCAGTATTGCTTGGAGGTACTGCCCTCCCTCTATAACCTCAACGAACATCTTAAGCAAGTGCACGAAGCTCAGGACCCAGGT
--E--Q--A--H--I--C--Q--Y--C--L--E--V--L--P--S--L--Y--N--L--N--E--H--L--K--Q--V--H--E--A--Q--D--P--G-

----------------------------------------------------------------------------------------------------
-L--I--V--S--A--M--P--A--I--V--Y--Q--C--N--F--C--S--E--V--V--N--D--L--N--T--L--Q--E--H--I--R--C--S--
CTGATTGTTTCTGCCATGCCTGCCATTGTCTACCAGTGTAACTTCTGTTCCGAAGTTGTCAACGACCTCAACACTCTTCAGGAACACATCCGATGTTCTC
::::::::::: :::::::::::::: :::::::::::.::::::::.::::::::::::::::::::::::::.:::::::::::.:::::::::::::
CTGATTGTTTCGGCCATGCCTGCCATAGTCTACCAGTGCAACTTCTGCTCCGAAGTTGTCAACGACCTCAACACCCTTCAGGAACATATCCGATGTTCTC
-L--I--V--S--A--M--P--A--I--V--Y--Q--C--N--F--C--S--E--V--V--N--D--L--N--T--L--Q--E--H--I--R--C--S--

----------------------------------------------------------------------------------------------------
H--G--F--A--N--P--A--A--K--D--S--N--A--F--F--C--P--H--C--Y--M--G--F--L--T--D--S--S--L--E--E--H--I--R
ATGGATTTGCAAACCCTGCAGCTAAAGATAGTAATGCATTCTTTTGTCCCCATTGCTATATGGGGTTTCTCACTGACTCTTCCCTGGAAGAGCATATTAG
:.::..::::.::::: ::.:::::.:::::.::::: :::::.::::::::::::::.:::::::::::::::::::::::::: ::::::::::: ::
ACGGGCTTGCGAACCCGGCGGCTAAGGATAGCAATGCTTTCTTCTGTCCCCATTGCTACATGGGGTTTCTCACTGACTCTTCCCTCGAAGAGCATATAAG
H--G--L--A--N--P--A--A--K--D--S--N--A--F--F--C--P--H--C--Y--M--G--F--L--T--D--S--S--L--E--E--H--I--R

----------------------------------------------------------------------------------------------------
--Q--V--H--C--D--L--S--G--S--R--F--G--S--P--V--L--G--T--P--K--E--P--V--V--E--V--Y--S--C--S--Y--C--T-
ACAGGTTCATTGTGACCTCAGTGGCTCCCGATTTGGGTCTCCAGTGCTTGGGACTCCCAAAGAACCAGTAGTAGAAGTCTATTCTTGTTCCTATTGTACA
.:::::.:::::::::::::::::::::::::::::::::::::::::.:::::::: :::::::::::::::::::::::::::::::::::::::::.
GCAGGTCCATTGTGACCTCAGTGGCTCCCGATTTGGGTCTCCAGTGCTCGGGACTCCAAAAGAACCAGTAGTAGAAGTCTATTCTTGTTCCTATTGTACG
--Q--V--H--C--D--L--S--G--S--R--F--G--S--P--V--L--G--T--P--K--E--P--V--V--E--V--Y--S--C--S--Y--C--T-

----------------------------------------------------------------------------------------------------
-N--S--P--I--F--N--S--V--L--K--L--N--K--H--I--K--E--N--H--K--N--I--P--L--A--L--N--Y--I--H--N--G--K--
AATTCGCCAATATTCAACAGCGTTCTTAAACTGAACAAGCATATCAAAGAGAATCATAAAAACATTCCCTTGGCCCTGAATTATATCCACAATGGGAAGA
:::::.:: ::::::::::::::::::::::: ::::::::.::::::::::::::.:::::::::::::::::::::::::::::.:::::.:::::::
AATTCACCCATATTCAACAGCGTTCTTAAACTCAACAAGCACATCAAAGAGAATCACAAAAACATTCCCTTGGCCCTGAATTATATTCACAACGGGAAGA
-N--S--P--I--F--N--S--V--L--K--L--N--K--H--I--K--E--N--H--K--N--I--P--L--A--L--N--Y--I--H--N--G--K--

----------------------------------------------------------------------------------------------------
K--S--R--A--L--S--P--L--S--P--V--A--I--E--Q--T--S--L--K--M--M--Q--A--V--G--G--A--P--A--R--P--T--G--E
AATCCAGGGCCTTAAGCCCCCTATCTCCTGTGGCCATAGAGCAGACATCTCTTAAGATGATGCAGGCAGTAGGAGGTGCACCTGCACGTCCCACTGGAGA
:::::::::::::.:::::::: :::::.:::::::::::.:::::::::::::::::::::::::::::.::.::.::..::::::: :: .: :::::
AATCCAGGGCCTTGAGCCCCCTCTCTCCCGTGGCCATAGAACAGACATCTCTTAAGATGATGCAGGCAGTGGGGGGCGCGTCTGCACGGCCAGCGGGAGA
K--S--R--A--L--S--P--L--S--P--V--A--I--E--Q--T--S--L--K--M--M--Q--A--V--G--G--A--S--A--R--P--A--G--E

----------------------------------------------------------------------------------------------------
--Y--I--C--N--Q--C--G--A--K--Y--T--S--L--D--S--F--Q--T--H--L--K--T--H--L--D--T--V--L--P--K--L--T--C-
ATATATCTGTAATCAATGTGGTGCTAAGTACACATCCCTAGACAGCTTTCAGACTCACCTAAAAACTCATCTCGACACTGTGCTTCCAAAATTGACCTGT
.::.:::::.:::::.::::::::::::::::: ::::::::::::::::::::::::::.::::::::::: ::::::::::: :: :::.: ::::::
GTACATCTGCAATCAGTGTGGTGCTAAGTACACTTCCCTAGACAGCTTTCAGACTCACCTGAAAACTCATCTGGACACTGTGCTGCCCAAACTTACCTGT
--Y--I--C--N--Q--C--G--A--K--Y--T--S--L--D--S--F--Q--T--H--L--K--T--H--L--D--T--V--L--P--K--L--T--C-

----------------------------------------------------------------------------------------------------
-P--Q--C--N--K--E--F--P--N--Q--E--S--L--L--K--H--V--T--I--H--F--M--I--T--S--T--Y--Y--I--C--E--S--C--
CCTCAGTGCAACAAGGAATTCCCCAACCAAGAATCCTTGCTGAAGCATGTTACCATTCACTTTATGATCACTTCAACGTATTACATCTGTGAGAGTTGTG
::.:::::.::::::::.:::::::::::.::.:::.::::::::::.::.:::::.::.::::::::.::::: :: ::.::.::::::::::::::::
CCCCAGTGTAACAAGGAGTTCCCCAACCAGGAGTCCCTGCTGAAGCACGTCACCATCCATTTTATGATTACTTCCACCTACTATATCTGTGAGAGTTGTG
-P--Q--C--N--K--E--F--P--N--Q--E--S--L--L--K--H--V--T--I--H--F--M--I--T--S--T--Y--Y--I--C--E--S--C--

----------------------------------------------------------------------------------------------------
D--K--Q--F--T--S--V--D--D--L--Q--K--H--L--L--D--M--H--T--F--V--F--F--R--C--T--L--C--Q--E--V--F--D--S
ACAAGCAATTCACATCAGTGGATGACCTTCAGAAACACCTGCTGGACATGCACACCTTTGTCTTCTTTCGCTGCACCCTCTGCCAGGAAGTTTTTGACTC
:::::::.::::::::.::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::.::::: ::.:::::
ACAAGCAGTTCACATCGGTGGATGACCTTCAGAAACACCTGCTGGACATGCACACCTTTGTCTTCTTTCGCTGCACCCTCTGCCAAGAAGTGTTCGACTC
D--K--Q--F--T--S--V--D--D--L--Q--K--H--L--L--D--M--H--T--F--V--F--F--R--C--T--L--C--Q--E--V--F--D--S

----------------------------------------------------------------------------------------------------
--K--V--S--I--Q--L--H--L--A--V--K--H--S--N--E--K--K--V--Y--R--C--T--S--C--N--W--D--F--R--N--E--T--D-
AAAAGTCTCCATTCAGCTCCACTTGGCTGTGAAGCACAGTAACGAAAAGAAAGTCTATAGGTGCACATCTTGCAACTGGGACTTCCGCAACGAAACTGAC
 :::::::::::.:::::::::::::: :::::::::::::::::.:::::::::::. : ::::::::.:::::::::::::::::.::.::.:: :::
CAAAGTCTCCATCCAGCTCCACTTGGCGGTGAAGCACAGTAACGAGAAGAAAGTCTACCGCTGCACATCCTGCAACTGGGACTTCCGTAATGAGACGGAC
--K--V--S--I--Q--L--H--L--A--V--K--H--S--N--E--K--K--V--Y--R--C--T--S--C--N--W--D--F--R--N--E--T--D-

----------------------------------------------------------------------------------------------------
-L--Q--L--H--V--K--H--N--H--L-----E--N--Q--G--K--V--H--K--C--I--F--C--G--E--S--F--G--T--E--V--E--L--
TTGCAGCTCCATGTGAAACACAACCACCTG---GAAAACCAAGGGAAAGTGCATAAGTGCATTTTCTGCGGTGAGTCCTTTGGCACCGAGGTGGAGCTGC
.::::::::::::::::.:::::::::::    ::.:::::.:: ::.:::::.::::::::.:::::::::::::::::.:::::::::::::::::::
CTGCAGCTCCATGTGAAGCACAACCACCTNG--GAGAACCAGGGCAAGGTGCACAAGTGCATCTTCTGCGGTGAGTCCTTCGGCACCGAGGTGGAGCTGC
-L--Q--L--H--V--K--H--N--H--X--\--E--N--Q--G--K--V--H--K--C--I--F--C--G--E--S--F--G--T--E--V--E--L--

----------------------------------------------------------------------------------------------------
Q--C--H--I--T--T--H--S--K--K--Y--N--C--K--F--C--S--K--A--F--H--A--I--I--L--L--E--K--H--L--R--E--K--H
AATGCCACATCACCACTCACAGTAAGAAGTACAACTGCAAGTTCTGTAGCAAAGCCTTCCATGCGATCATTTTGTTAGAAAAACACTTGCGAGAAAAACA
:.::::::::::::::.:::::.:::: :::::::::::::::::::::::::::::::::.:: :::::..::.:.::.::.:::.:::: ::.::.::
AGTGCCACATCACCACCCACAGCAAGANGTACAACTGCAAGTTCTGTAGCAAAGCCTTCCACGCCATCATCCTGCTGGAGAAGCACCTGCGCGAGAAGCA
Q--C--H--I--T--T--H--S--K--X--Y--N--C--K--F--C--S--K--A--F--H--A--I--I--L--L--E--K--H--L--R--E--K--H

----------------------------------------------------------------------------------------------------
--C--V--F--E--T--K--T--P--N--C--G--T--N--G--A--S-----E--Q--V--Q--K--E--E--V--E--L--Q--T--L--L--T--N-
CTGTGTATTCGAAACCAAGACACCCAACTGTGGAACAAATGGAGCTTCC---GAGCAAGTGCAGAAAGAGGAAGTGGAGCTGCAGACTTTGCTGACCAAC
:::.::.::. ::: ::::::.::::  ::::: .: :  ::.::.::    :::::.::.:::::.:::                              
CTGCGTGTTTNAAAACAAGACGCCCANNTGTGGCGCNANGGGGGCCTCGG--GAGCAGGTACAGAAGGAG------------------------------
--C--V--F--X--N--K--T--P--X--C--G--X--X--G--A--S--\--E--Q--V--Q--K--E-------------------------------

----------------------------------------------------------------------------------------------------
-S--Q--E--S--H--N--S--H--D--G--S--E--E--D--V--D--T--S--E--P--M--Y--G--C--D--I--C--G--A--A--Y--T--M--
AGCCAGGAGTCCCACAACAGTCACGATGGGAGCGAAGAAGACGTTGACACCTCTGAGCCTATGTACGGCTGCGACATTTGTGGGGCAGCCTACACTATGG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
E--T--L--L--Q--N--H--Q--L--R--D--H--N--I--R--P--G--E--S--A--I--V--K--K--K--A--E--L--I--K--G--N--Y--K
AAACTTTGCTGCAGAATCACCAGCTCCGAGACCACAACATCAGACCTGGAGAAAGTGCCATCGTGAAAAAGAAAGCTGAGCTCATTAAAGGGAATTACAA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--C--N--V--C--S--R--T--F--F--S--E--N--G--L--R--E--H--M--Q--T--H--L--G--P--V--K--H--Y--M--C--P--I--C-
GTGCAACGTGTGCTCTCGAACCTTCTTCTCCGAAAATGGCCTCCGGGAACATATGCAGACCCACCTAGGCCCTGTCAAACACTACATGTGCCCTATTTGC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-G--E--R--F--P--S--L--L--T--L--T--E--H--K--V--T--H--S--K--S--L--D--T--G--N--C--R--I--C--K--M--P--L--
GGAGAGCGGTTTCCCTCCCTTTTAACTCTTACTGAACACAAAGTCACGCATAGTAAGAGTCTTGATACTGGAAACTGCCGGATTTGCAAGATGCCTCTCC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
Q--S--E--E--E--F--L--E--H--C--Q--M--H--P--D--L--R--N--S--L--T--G--F--R--C--V--V--C--M--Q--T--V--T--S
AGAGTGAAGAGGAGTTTTTAGAGCATTGCCAAATGCACCCTGACTTGAGGAATTCCCTGACAGGCTTTCGCTGCGTGGTGTGCATGCAGACAGTGACCTC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--T--L--E--L--K--I--H--G--T--F--H--M--Q--K--T--G--N--G--S--A--V--Q--T--T--G--R--G--Q--H--V--Q--K--L-
CACCTTGGAACTCAAAATCCATGGGACGTTCCACATGCAAAAGACAGGGAATGGGTCTGCAGTTCAGACCACAGGGCGGGGCCAGCACGTCCAAAAACTG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-Y--K--C--A--S--C--L--K--E--F--R--S--K--Q--D--L--V--K--L--D--I--N--G--L--P--Y--G--L--C--A--G--C--V--
TATAAGTGCGCATCTTGCCTCAAAGAATTCCGTTCCAAGCAAGATCTGGTGAAACTTGATATCAATGGCCTGCCATATGGTCTGTGTGCCGGCTGCGTGA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
N--L--S--K--S--A--S--P--G--I--N--V--P--P--G--T--N--R--P--G--L--G--Q--N--E--N--L--S--A--I--E--G--K--G
ATCTCAGTAAGAGCGCCAGCCCAGGCATTAACGTCCCTCCCGGCACGAATAGACCAGGCTTGGGCCAGAATGAGAATCTGAGTGCCATTGAGGGGAAAGG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--K--V--G--G--L--K--T--R--C--S--S--C--N--V--K--F--E--S--E--S--E--L--Q--N--H--I--Q--T--I--H--R--E--L-
CAAGGTGGGGGGACTGAAGACACGCTGCTCTAGCTGCAACGTTAAGTTTGAGTCTGAAAGTGAACTCCAGAACCACATCCAAACCATCCACCGAGAGCTC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

--------------------------------------------------------------------------------><------------------
-V--P--D--S--N--S--T--Q--L--K--T--P--Q--V--S--P--M--P--R--I--S--P--S--Q--S--D--E--K--K--T--Y--Q--C--
GTGCCAGACAGCAACAGCACACAGTTGAAAACGCCCCAAGTATCACCAATGCCCAGAATCAGTCCCTCCCAGTCGGATGAGAAGAAGACCTATCAATGCA
                                                                                    :::::::::::.::::
------------------------------------------------------------------------------------AAGACCTATCAGTGCA
-------------------------------------------------------------------------------------K--T--Y--Q--C--

-----------------------------------------------------------------><---------------------------------
I--K--C--Q--M--V--F--Y--N--E--W--D--I--Q--V--H--V--A--N--H--M--I--D--E--G--L--N--H--E--C--K--L--C--S
TCAAGTGTCAGATGGTTTTCTACAATGAATGGGATATTCAGGTTCATGTTGCAAATCACATGATTGATGAAGGACTGAACCATGAATGCAAACTCTGCAG
::::::::::::::::::::::::::::::::::::::::::: :::::::::::::::::::::   ::::::::::::::::::::::::::::::::
TCAAGTGTCAGATGGTTTTCTACAATGAATGGGATATTCAGGTGCATGTTGCAAATCACATGATT---GAAGGACTGAACCATGAATGCAAACTCTGCAG
I--K--C--Q--M--V--F--Y--N--E--W--D--I--Q--V--H--V--A--N--H--M--I-----E--G--L--N--H--E--C--K--L--C--S

-------------------------------------------------------------------------------------------------><-
--Q--T--F--D--S--P--A--K--L--Q--C--H--L--I--E--H--S--F--E--G--M--G--G--T--F--K--C--P--V--C--F--T--V-
CCAGACCTTTGACTCTCCTGCCAAACTCCAGTGCCACCTGATAGAGCACAGCTTCGAAGGGATGGGAGGCACCTTCAAGTGTCCAGTCTGCTTTACAGTA
:::::::::.:::::.:::::::::::::::::::::::::: :::::::::::::::::.::::: :::::.::::::::::: ::.:::::::::   
CCAGACCTTCGACTCCCCTGCCAAACTCCAGTGCCACCTGATCGAGCACAGCTTCGAAGGAATGGGTGGCACTTTCAAGTGTCCCGTTTGCTTTACA---
--Q--T--F--D--S--P--A--K--L--Q--C--H--L--I--E--H--S--F--E--G--M--G--G--T--F--K--C--P--V--C--F--T----

----------------------------------------------------------------------------------------------------
-F--V--Q--A--N--K--L--Q--Q--H--I--F--S--A--H--G--Q--E--D--K--I--Y--D--C--T--Q--C--P--Q--K--F--F--F--
TTTGTTCAAGCAAACAAGTTGCAGCAGCATATTTTCTCTGCCCATGGACAAGAAGACAAGATCTATGACTGTACACAATGTCCACAGAAGTTTTTCTTCC
:::::::::::::::::::::::::::::::::::::::::.:::::::::::::::::::::::::::::.::.:::::::::::::::::::::::::
TTTGTTCAAGCAAACAAGTTGCAGCAGCATATTTTCTCTGCTCATGGACAAGAAGACAAGATCTATGACTGCACGCAATGTCCACAGAAGTTTTTCTTCC
-F--V--Q--A--N--K--L--Q--Q--H--I--F--S--A--H--G--Q--E--D--K--I--Y--D--C--T--Q--C--P--Q--K--F--F--F--

-------------><---------------------------->
Q--T--E--L--Q--N--H--T--M--T--Q--H--S--S--*-
AAACAGAGCTGCAGAATCATACAATGACCCAACACAGCAGTTAG
::::::::::::::                              
AAACAGAGCTGCAG------------------------------
Q--T--E--L--Q-------------------------------

Pig Consensus Sequence

>BGISUST0000892431
TTCCTCAGTGATTACGTACAGAGCGAGTCCCTGCGGGTTAGGGGCCCCCTCTGGAGCCATCCTGATGGCTTTGGGGGCCTTGCTTCCATTTTCCATTATT
ATGTGGACTACCGGAGCGACAGCGCAGTCCAAGACCTTGCA-----------------------------------------------------------
-------GAAGACGGAGAGGAGCTAGAAGGCGAAGCTGTGCACAGCTGTGACAGCTGCCTCCAGGTGTTCGAGTCACTGAGCGATATCACAGAACACAAG
ATTAATCAATGTCAGCTGACA-------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
-GAGCAAGCCCACATTTGTCAGTATTGCTTGGAGGTACTGCCCTCCCTCTATAACCTCAACGAACATCTTAAGCAAGTGCACGAAGCTCAGGACCCAGGT
CTGATTGTTTCGGCCATGCCTGCCATAGTCTACCAGTGCAACTTCTGCTCCGAAGTTGTCAACGACCTCAACACCCTTCAGGAACATATCCGATGTTCTC
ACGGGCTTGCGAACCCGGCGGCTAAGGATAGCAATGCTTTCTTCTGTCCCCATTGCTACATGGGGTTTCTCACTGACTCTTCCCTCGAAGAGCATATAAG
GCAGGTCCATTGTGACCTCAGTGGCTCCCGATTTGGGTCTCCAGTGCTCGGGACTCCAAAAGAACCAGTAGTAGAAGTCTATTCTTGTTCCTATTGTACG
AATTCACCCATATTCAACAGCGTTCTTAAACTCAACAAGCACATCAAAGAGAATCACAAAAACATTCCCTTGGCCCTGAATTATATTCACAACGGGAAGA
AATCCAGGGCCTTGAGCCCCCTCTCTCCCGTGGCCATAGAACAGACATCTCTTAAGATGATGCAGGCAGTGGGGGGCGCGTCTGCACGGCCAGCGGGAGA
GTACATCTGCAATCAGTGTGGTGCTAAGTACACTTCCCTAGACAGCTTTCAGACTCACCTGAAAACTCATCTGGACACTGTGCTGCCCAAACTTACCTGT
CCCCAGTGTAACAAGGAGTTCCCCAACCAGGAGTCCCTGCTGAAGCACGTCACCATCCATTTTATGATTACTTCCACCTACTATATCTGTGAGAGTTGTG
ACAAGCAGTTCACATCGGTGGATGACCTTCAGAAACACCTGCTGGACATGCACACCTTTGTCTTCTTTCGCTGCACCCTCTGCCAAGAAGTGTTCGACTC
CAAAGTCTCCATCCAGCTCCACTTGGCGGTGAAGCACAGTAACGAGAAGAAAGTCTACCGCTGCACATCCTGCAACTGGGACTTCCGTAATGAGACGGAC
CTGCAGCTCCATGTGAAGCACAACCACCTngAGAACCAGGGCAAGGTGCACAAGTGCATCTTCTGCGGTGAGTCCTTCGGCACCGAGGTGGAGCTGCAGT
GCCACATCACCACCCACAGCAAGANGTACAACTGCAAGTTCTGTAGCAAAGCCTTCCACGCCATCATCCTGCTGGAGAAGCACCTGCGCGAGAAGCACTG
CGTGTTTNAAAACAAGACGCCCANNTGTGGCGCNANGGGGGCCTCggAGCAGGTACAGAAGGAG------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
------------------------------------------------------------------------------AAGACCTATCAGTGCATCAAGT
GTCAGATGGTTTTCTACAATGAATGGGATATTCAGGTGCATGTTGCAAATCACATGATT---GAAGGACTGAACCATGAATGCAAACTCTGCAGCCAGAC
CTTCGACTCCCCTGCCAAACTCCAGTGCCACCTGATCGAGCACAGCTTCGAAGGAATGGGTGGCACTTTCAAGTGTCCCGTTTGCTTTACA---TTTGTT
CAAGCAAACAAGTTGCAGCAGCATATTTTCTCTGCTCATGGACAAGAAGACAAGATCTATGACTGCACGCAATGTCCACAGAAGTTTTTCTTCCAAACAG
AGCTGCAG------------------------------


>BGISUSP0000892431
FLSDYVQSESLRVRGPLWSHPDGFGGLASIFHYYVDYRSDSAVQDLA----------------------EDGEELEGEAVHSCDSCLQVFESLSDITEHK
INQCQLT---------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
-------------------------------------------------------------------EQAHICQYCLEVLPSLYNLNEHLKQVHEAQDPG
LIVSAMPAIVYQCNFCSEVVNDLNTLQEHIRCSHGLANPAAKDSNAFFCPHCYMGFLTDSSLEEHIRQVHCDLSGSRFGSPVLGTPKEPVVEVYSCSYCT
NSPIFNSVLKLNKHIKENHKNIPLALNYIHNGKKSRALSPLSPVAIEQTSLKMMQAVGGASARPAGEYICNQCGAKYTSLDSFQTHLKTHLDTVLPKLTC
PQCNKEFPNQESLLKHVTIHFMITSTYYICESCDKQFTSVDDLQKHLLDMHTFVFFRCTLCQEVFDSKVSIQLHLAVKHSNEKKVYRCTSCNWDFRNETD
LQLHVKHNH-ENQGKVHKCIFCGESFGTEVELQCHITTHSK-YNCKFCSKAFHAIILLEKHLREKHCVF-NKTP-CG--GASEQVQKE------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
--------------------------KTYQCIKCQMVFYNEWDIQVHVANHMI-EGLNHECKLCSQTFDSPAKLQCHLIEHSFEGMGGTFKCPVCFT-FV
QANKLQQHIFSAHGQEDKIYDCTQCPQKFFFQTELQ----------