Sequences
EST Library Info
eep2Foetus 50 days, epidermis
ese2Foetus 50 days, M. semitendinosus
nlu1Newborn 115 days, lung
pigcb4Unavailable
Clusters
Oligos
SNPs

Gene ID ENSG00000198752 (click for geneview)
Transcript ID ENST00000361990(link to ensembl)
Symbol CDC42BPB
Localtion Chromosome:14:102468470:102593552:-1 band: 14q32.32
Description CDC42-binding protein kinase beta [Source:RefSeq_peptide;Acc:NP_006026]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-A--G--A--R--R--R--G--R--G--G--E--E--A--P--L--L--G--P--W--R--N--E--S--A--L--S--V--E--T--L--L--D--V--
GCCGGGGCGCGACGACGCGGACGGGGCGGCGAGGAGGCGCCGCTGCTGCCGGGGCTCGCAGCCGCCGAGCCCCCGAGGGCGCGCCCTGACGGACTGGCCG
                                                  :   .     . ::  ..  :::.::: :.: .  :          :.  
------------------------------------------------GGGCCCTGGCGCAACGAGAGCGCCCTGAGCGTGGAGACGCTGCTCGACGTGC
-------------------------------------------------G--P--W--R--N--E--S--A--L--S--V--E--T--L--L--D--V--

----------------------------------------------------------------------------------------------------
L--V--C--L--Y--T--E--C--S--H--S--A--L--R--R--D--K--Y--V--A--E--F--L--E--W--L--E--Q--L--L--L--D--G--P
AGCCGGCGGTGAGAGGCCGGCGCGTCGGGAGCGGGCCGCGCGGCACCATGTCGGCCAAGGTGCGGCTCAAGAAGCTGGAGCAGCTGCTCCTGGACGGGCC
   .     :: . . : .:.::. : .    :  :.:::: ::. :: ::  :. .  : :.  :::.:: .:                          
TCGTCTGCCTGTACACCGAGTGCAGCCACTCGGCCCTGCGCCGCGACAAGTATGTGGCCGAGTTCCTCGAGTGG--------------------------
L--V--C--L--Y--T--E--C--S--H--S--A--L--R--R--D--K--Y--V--A--E--F--L--E--W---------------------------

----------------------------------------------------------------------------------------------------
--W--R--N--E--S--A--L--S--V--E--T--L--L--D--V--L--V--C--L--Y--T--E--C--S--H--S--A--L--R--R--D--K--Y-
CTGGCGCAACGAGAGCGCCCTGAGCGTGGAAACGCTGCTCGACGTGCTCGTCTGCCTGTACACCGAGTGCAGCCACTCGGCCCTGCGCCGCGACAAGTAC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

---------------------><-----------------------------------------------------------------------------
-V--A--E--F--L--E--W--A--K--P--F--T--Q--L--V--K--E--M--Q--L--H--R--E--D--F--E--I--I--K--V--I--G--R--
GTGGCCGAGTTCCTCGAGTGGGCTAAACCATTTACACAGCTGGTGAAAGAAATGCAGCTTCATCGAGAAGACTTTGAAATAATTAAAGTAATTGGAAGAG
                        :::::::::::::::::::::::.::::::::.:::::::::::::::::.:::::::::::::::::::::::::
------------------------AAACCATTTACACAGCTGGTGAAGGAAATGCAACTTCATCGAGAAGACTTCGAAATAATTAAAGTAATTGGAAGAG
-------------------------K--P--F--T--Q--L--V--K--E--M--Q--L--H--R--E--D--F--E--I--I--K--V--I--G--R--

-------------><----------------------------------------------------------------------------------><-
G--A--F--G--E--V--A--V--V--K--M--K--N--T--E--R--I--Y--A--M--K--I--L--N--K--W--E--M--L--K--R--A--E--T
GTGCTTTTGGTGAGGTTGCTGTTGTCAAAATGAAGAATACTGAACGAATTTATGCAATGAAAATCCTCAACAAGTGGGAGATGCTGAAAAGAGCAGAGAC
:::::::.::.:::::.::::: ::::..:::::::..::.::.:: ::.::.:: :::::.::.:::::::::::::::::::::::. ::::::::::
GTGCTTTCGGCGAGGTCGCTGTGGTCAGGATGAAGAGCACCGAGCGCATCTACGCCATGAAGATTCTCAACAAGTGGGAGATGCTGAAGCGAGCAGAGAC
G--A--F--G--E--V--A--V--V--R--M--K--S--T--E--R--I--Y--A--M--K--I--L--N--K--W--E--M--L--K--R--A--E--T

---------------------------------------------------------------------------------------------><-----
--A--C--F--R--E--E--R--D--V--L--V--N--G--D--C--Q--W--I--T--A--L--H--Y--A--F--Q--D--E--N--H--L--Y--L-
CGCGTGCTTCCGAGAGGAGCGCGATGTGCTGGTGAACGGCGACTGCCAGTGGATCACCGCGCTGCACTACGCCTTTCAGGACGAGAACCACCTGTACTTA
 :: ::.:::::.:::::::: ::.::::::::::::::::::: .:::::: :::::.::::::::::::::::::::::.::.:::.:.::::::.:.
GGCTTGTTTCCGGGAGGAGCGGGACGTGCTGGTGAACGGCGACTCTCAGTGGCTCACCACGCTGCACTACGCCTTTCAGGATGAAAACTATCTGTACCTG
--A--C--F--R--E--E--R--D--V--L--V--N--G--D--S--Q--W--L--T--T--L--H--Y--A--F--Q--D--E--N--Y--L--Y--L-

----------------------------------------------------------------------------------------------------
-V--M--D--Y--Y--V--G--G--D--L--L--T--L--L--S--K--F--E--D--K--L--P--E--D--M--A--R--F--Y--I--G--E--M--
GTCATGGATTACTATGTGGGTGGTGATTTACTGACCCTGCTCAGCAAATTTGAAGACAAGCTTCCGGAAGATATGGCGAGGTTCTACATTGGTGAAATGG
::::::::.::::: :::::.::.::..:.:::::::::::::::::.::.:::::: .:::.:::::.::.:::::: ::::::::::.:: ::.::::
GTCATGGACTACTAAGTGGGCGGCGACCTGCTGACCCTGCTCAGCAAGTTCGAAGACCGGCTCCCGGAGGACATGGCGCGGTTCTACATCGGGGAGATGG
-V--M--D--Y--*--V--G--G--D--L--L--T--L--L--S--K--F--E--D--R--L--P--E--D--M--A--R--F--Y--I--G--E--M--

------------------------------------------><--------------------------------------------------------
V--L--A--I--D--S--I--H--Q--L--H--Y--V--H--R--D--I--K--P--D--N--V--L--L--D--V--N--G--H--I--R--L--A--D
TGCTGGCCATTGACTCCATCCATCAGCTTCATTACGTGCACAGAGACATTAAACCTGACAATGTCCTTTTGGACGTGAATGGTCATATCCGCCTGGCTGA
::::::::::.:::::::::::::::::.::.:::::::::   :::::::::::::::::::::::::::::.:::::::::::::::::::::::.::
TGCTGGCCATCGACTCCATCCATCAGCTCCACTACGTGCAC---GACATTAAACCTGACAATGTCCTTTTGGATGTGAATGGTCATATCCGCCTGGCCGA
V--L--A--I--D--S--I--H--Q--L--H--Y--V--H-----D--I--K--P--D--N--V--L--L--D--V--N--G--H--I--R--L--A--D

------------------------------------><--------------------------------------------------------------
--F--G--S--C--L--K--M--N--D--D--G--T--V--Q--S--S--V--A--V--G--T--P--D--Y--I--S--P--E--I--L--Q--A--M-
CTTTGGATCATGTTTGAAGATGAATGATGATGGCACTGTGCAGTCCTCCGTGGCCGTGGGCACACCTGACTACATCTCGCCGGAGATCCTGCAGGCGATG
::::::::::::::::::::::::::::::::: ::::: ::::::::::::::::: ::::: :: ::::::::::: :::::::::::::::::::::
CTTTGGATCATGTTTGAAGATGAATGATGATGGAACTGTCCAGTCCTCCGTGGCCGTCGGCACCCCGGACTACATCTCCCCGGAGATCCTGCAGGCGATG
--F--G--S--C--L--K--M--N--D--D--G--T--V--Q--S--S--V--A--V--G--T--P--D--Y--I--S--P--E--I--L--Q--A--M-

----------------------------------------------------------------------------------------------------
-E--D--G--M--G--K--Y--G--P--E--C--D--W--W--S--L--G--V--C--M--Y--E--M--L--Y--G--E--T--P--F--Y--A--E--
GAGGACGGCATGGGCAAATACGGGCCTGAGTGTGACTGGTGGTCTCTGGGTGTCTGCATGTATGAGATGCTCTATGGAGAAACGCCGTTTTATGCGGAGT
::::::::::::::::..::::: ::.:::::.::::::::::: :::::.:::::::::::.:::::::::::.:::::.:::::::::::.:: ::::
GAGGACGGCATGGGCAGGTACGGCCCCGAGTGCGACTGGTGGTCGCTGGGCGTCTGCATGTACGAGATGCTCTACGGAGAGACGCCGTTTTACGCCGAGT
-E--D--G--M--G--R--Y--G--P--E--C--D--W--W--S--L--G--V--C--M--Y--E--M--L--Y--G--E--T--P--F--Y--A--E--

-------------------------------------><-------------------------------------------------------------
S--L--V--E--T--Y--G--K--I--M--N--H--E--E--R--F--Q--F--P--S--H--V--T--D--V--S--E--E--A--K--D--L--I--Q
CACTCGTGGAGACCTATGGGAAGATCATGAACCATGAAGAGCGATTCCAGTTCCCATCCCATGTCACGGATGTATCTGAAGAAGCGAAGGACCTCATCCA
:.:: :::::::::::.:: ::::::::::::                                                                    
CGCTGGTGGAGACCTACGGCAAGATCATGAAC--------------------------------------------------------------------
S--L--V--E--T--Y--G--K--I--M--N---------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--R--L--I--C--S--R--E--R--R--L--G--Q--N--G--I--E--D--F--K--K--H--A--F--F--E--G--L--N--W--E--N--I--R-
GAGACTGATCTGCAGTAGAGAACGCCGGCTGGGGCAGAATGGAATAGAGGATTTCAAAAAGCATGCGTTTTTTGAAGGTCTAAATTGGGAAAATATACGA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

--------------------------------------------------------------------------------------><------------
-N--L--E--A--P--Y--I--P--D--V--S--S--P--S--D--T--S--N--F--D--V--D--D--D--V--L--R--N--T--E--I--L--P--
AACCTAGAAGCACCTTATATTCCTGATGTGAGCAGTCCCTCTGACACATCCAACTTCGACGTGGATGACGACGTGCTGAGAAACACGGAAATATTACCTC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

------------------------------------------------------------------><--------------------------------
P--G--S--H--T--G--F--S--G--L--H--L--P--F--I--G--F--T--F--T--T--E--S--C--F--S--D--R--G--S--L--K--S--I
CTGGTTCTCACACAGGCTTTTCTGGATTACATTTGCCATTCATTGGTTTTACATTCACAACGGAAAGCTGTTTTTCTGATCGAGGCTCTCTGAAGAGCAT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--M--Q--S--N--T--L--T--K--D--E--D--V--Q--R--D--L--E--H--S--L--Q--M--E--A--Y--E--R--R--I--R--R--L--E-
AATGCAGTCCAACACATTAACCAAAGATGAGGATGTGCAGCGGGACCTGGAGCACAGCCTGCAGATGGAAGCTTACGAGAGGAGGATTCGGAGGCTGGAA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

---------------------------------><-----------------------------------------------------------------
-Q--E--K--L--E--L--S--R--K--L--Q--E--S--T--Q--T--V--Q--S--L--H--G--S--S--R--A--L--S--N--S--N--R--D--
CAGGAGAAGCTGGAGCTGAGCAGGAAGCTGCAAGAGTCCACCCAGACCGTGCAGTCCCTCCACGGCTCATCTCGGGCCCTCAGCAATTCAAACCGAGATA
                                       ::::::::::::::::::.:::::::: :: :.:::.:::: .:::.: : . ::: ::.:
---------------------------------------ACCCAGACCGTGCAGTCCTTCCACGGCGCAGCCCGGACCCTGGGCAGTGCCGCCCGTGACA
----------------------------------------T--Q--T--V--Q--S--F--H--G--A--A--R--T--L--G--S--A--A--R--D--

-----------------------------------------------------><---------------------------------------------
K--E--I--K--K--L--N--E--E--I--E--R--L--K--N--K--I--A--D--S--N--R--L--E--R--Q--L--E--D--T--V--A--L--R
AAGAAATCAAAAAGCTAAATGAAGAAATCGAACGCTTGAAGAATAAAATAGCAGATTCAAACAGGCTCGAGCGACAGCTTGAGGACACAGTGGCGCTTCG
:::::::::::::::: ::.::::::::.:::::.::::::::::::::::::                                               
AAGAAATCAAAAAGCTCAACGAAGAAATTGAACGTTTGAAGAATAAAATAGCA-----------------------------------------------
K--E--I--K--K--L--N--E--E--I--E--R--L--K--N--K--I--A------------------------------------------------

---------------------------------------------------------------------------------------><-----------
--Q--E--R--E--D--S--T--Q--R--L--R--G--L--E--K--Q--H--R--V--V--R--Q--E--K--E--E--L--H--K--Q--L--V--E-
CCAAGAGCGTGAGGACTCCACGCAGCGGCTGCGGGGGCTGGAGAAGCAGCACCGCGTGGTCCGGCAGGAGAAGGAGGAGCTGCACAAGCAACTGGTTGAA
                                                                                        :::.::.:::::
----------------------------------------------------------------------------------------CAATTGATTGAA
-----------------------------------------------------------------------------------------Q--L--I--E-

----------------------------------------------------------------------------------------------------
-A--S--E--R--L--K--S--Q--A--K--E--L--K--D--A--H--Q--Q--R--K--L--A--L--Q--E--F--S--E--L--N--E--R--M--
GCCTCAGAGCGGTTGAAATCCCAGGCCAAGGAACTCAAAGATGCCCATCAGCAGCGAAAGCTGGCCCTGCAGGAGTTCTCGGAGCTGAACGAGCGCATGG
::.:: ::::::.::::.::::::::::.:::::: ::.::.:::::.::::::::.::::::::::::::::::::::::::::: :::::::::::::
GCTTCCGAGCGGCTGAAGTCCCAGGCCAGGGAACTGAAGGACGCCCACCAGCAGCGGAAGCTGGCCCTGCAGGAGTTCTCGGAGCTCAACGAGCGCATGG
-A--S--E--R--L--K--S--Q--A--R--E--L--K--D--A--H--Q--Q--R--K--L--A--L--Q--E--F--S--E--L--N--E--R--M--

----------------------------------------------------------------------------------------------------
A--E--L--R--A--Q--K--Q--K--V--S--R--Q--L--R--D--K--E--E--E--M--E--V--A--T--Q--K--V--D--A--M--R--Q--E
CAGAGCTCCGTGCCCAGAAGCAGAAGGTGTCCCGGCAGCTGCGAGACAAGGAGGAGGAGATGGAGGTGGCCACGCAGAAGGTGGACGCCATGCGGCAGGA
: ::::::::. :::::::::::::::::::.:::::::::::.::: ..:::::::::.:::  :.:::: .:::::::.: :::::: ::::::::::
CCGAGCTCCGCTCCCAGAAGCAGAAGGTGTCTCGGCAGCTGCGGGACCGAGAGGAGGAGGTGGNNGCGGCCTTGCAGAAGATCGACGCCCTGCGGCAGGA
A--E--L--R--S--Q--K--Q--K--V--S--R--Q--L--R--D--R--E--E--E--V--X--A--A--L--Q--K--I--D--A--L--R--Q--E

------------------------------><--------------------------------------------------------------------
--M--R--R--A--E--K--L--R--K--E--L--E--A--Q--L--D--D--A--V--A--E--A--S--K--E--R--K--L--R--E--H--S--E-
AATGCGGAGAGCTGAGAAGCTCAGGAAAGAGCTGGAAGCTCAGCTTGATGATGCTGTTGCTGAGGCCTCCAAGGAGCGCAAGCTTCGTGAGCACAGCGAG
..: :: ::.::.:: :::. : ::::.:::                                                                     
GGTCCGCAGGGCCGACAAGTGCCGGAAGGAG---------------------------------------------------------------------
--V--R--R--A--D--K--C--R--K--E----------------------------------------------------------------------

-----------------------------------------><---------------------------------------------------------
-N--F--C--K--Q--M--E--S--E--L--E--A--L--K--V--K--Q--G--G--R--G--A--G--A--T--L--E--H--Q--Q--E--I--S--
AACTTCTGCAAGCAAATGGAAAGCGAGCTGGAGGCCCTCAAGGTGAAGCAAGGAGGCCGGGGAGCGGGTGCCACCTTAGAGCACCAGCAAGAGATTTCCA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
K--I--K--S--E--L--E--K--K--V--L--F--Y--E--E--E--L--V--R--R--E--A--S--H--V--L--E--V--K--N--V--K--K--E
AAATCAAATCCGAGCTGGAGAAGAAAGTCTTATTTTATGAAGAGGAATTGGTCAGACGTGAGGCCTCCCATGTGCTAGAAGTGAAAAATGTGAAGAAGGA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

--------------------------------------------------------------------------------------><------------
--V--H--D--S--E--S--H--Q--L--A--L--Q--K--E--I--L--M--L--K--D--K--L--E--K--S--K--R--E--R--H--N--E--M-
GGTGCATGATTCAGAAAGCCACCAGCTGGCCCTGCAGAAAGAAATCTTGATGTTAAAAGATAAGTTAGAAAAGTCAAAGCGAGAACGGCATAACGAGATG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

--------------------------------------------------------------------------------------------><------
-E--E--A--V--G--T--I--K--D--K--Y--E--R--E--R--A--M--L--F--D--E--N--K--K--L--T--A--E--N--E--K--L--C--
GAGGAGGCAGTAGGTACAATAAAAGATAAATACGAACGAGAAAGAGCGATGCTGTTTGATGAAAACAAGAAGCTAACTGCTGAAAATGAAAAGCTCTGTT
                                                                                             ::.::: 
---------------------------------------------------------------------------------------------CTTTGTG
----------------------------------------------------------------------------------------------L--C--

----------------------------------------------------------------------------------------------------
S--F--V--D--K--L--T--A--Q--N--R--Q--L--E--D--E--L--Q--D--L--A--A--K--K--E--S--V--A--H--W--E--A--Q--I
CCTTTGTGGATAAACTCACAGCTCAAAATAGACAGCTGGAGGATGAGCTGCAGGATCTGGCAGCCAAGAAGGAGTCAGTGGCCCACTGGGAAGCTCAGAT
:::::::::::::.:::::::::::::::::.:::.:::::::.:::::::::::::::::.::::::::::::::.:: ::::::::::::::.:::::
CCTTTGTGGATAAGCTCACAGCTCAAAATAGGCAGTTGGAGGACGAGCTGCAGGATCTGGCGGCCAAGAAGGAGTCGGTTGCCCACTGGGAAGCCCAGAT
A--F--V--D--K--L--T--A--Q--N--R--Q--L--E--D--E--L--Q--D--L--A--A--K--K--E--S--V--A--H--W--E--A--Q--I

-----------------><---------------------------------------------------------------------------------
--A--E--I--I--Q--W--V--S--D--E--K--D--A--R--G--Y--L--Q--A--L--A--S--K--M--T--E--E--L--E--A--L--R--S-
TGCGGAAATCATTCAGTGGGTCAGTGACGAGAAAGATGCCCGGGGTTACCTTCAAGCTCTTGCTTCCAAGATGACCGAAGAGCTCGAGGCTTTGAGGAGT
.::.::.:::::::::                                                                                    
CGCAGAGATCATTCAG------------------------------------------------------------------------------------
--A--E--I--I--Q-------------------------------------------------------------------------------------

-----------------------><---------------------------------------------------------------------------
-S--S--L--G--S--R--T--L--D--P--L--W--K--V--R--R--S--Q--K--L--D--M--S--A--R--L--E--L--Q--S--A--L--E--
TCTAGTCTGGGGTCAAGAACACTGGACCCGCTGTGGAAGGTGCGCCGCAGCCAGAAGCTGGACATGTCCGCGCGGCTGGAGCTGCAGTCGGCCCTGGAGG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

------------------------------------------------------------------------><--------------------------
A--E--I--R--A--K--Q--L--V--Q--E--E--L--R--K--V--K--D--A--N--L--T--L--E--S--K--L--K--D--S--E--A--K--N
CGGAGATCCGGGCCAAGCAGCTTGTCCAGGAGGAGCTCAGGAAGGTCAAGGACGCCAACCTCACCTTGGAAAGCAAACTAAAGGATTCCGAAGCCAAAAA
        ::::::::::::::.:::::::::::::: :::::::::::::::.. ::.::: :::: :::   ::::::::::::::.:::::::::::
--------CGGGCCAAGCAGCTCGTCCAGGAGGAGCTGAGGAAGGTCAAGGACATGAATCTCTCCTTCGAA---AAACTAAAGGATTCTGAAGCCAAAAA
---------R--A--K--Q--L--V--Q--E--E--L--R--K--V--K--D--M--N--L--S--F--E-----K--L--K--D--S--E--A--K--N

-------------------------------------------------------------------><-------------------------------
--R--E--L--L--E--E--M--E--I--L--K--K--K--M--E--E--K--F--R--A--D--T--G--L--K--L--P--D--F--Q--D--S--I-
CAGAGAATTATTAGAAGAAATGGAAATTTTGAAGAAAAAGATGGAAGAAAAATTCAGAGCAGATACTGGGCTCAAACTTCCAGATTTTCAGGATTCCATT
.:::::::::::::::::::::::::::::::::::.:::::::::::::::::.:::.:::::      :::::::::::::::::.::::::::::::
TAGAGAATTATTAGAAGAAATGGAAATTTTGAAGAAGAAGATGGAAGAAAAATTTAGAACAGAT------CTCAAACTTCCAGATTTCCAGGATTCCATT
--R--E--L--L--E--E--M--E--I--L--K--K--K--M--E--E--K--F--R--T--D--------L--K--L--P--D--F--Q--D--S--I-

-----------------------------------------------><---------------------------------------------------
-F--E--Y--F--N--T--A--P--L--A--H--D--L--T--F--R--T--S--S--A--S--E--Q--E--T--Q--A--P--K--P--E--A--S--
TTTGAGTATTTCAACACTGCTCCTCTTGCACATGACCTGACATTTAGAACCAGCTCAGCTAGTGAGCAAGAAACACAAGCTCCGAAGCCAGAAGCGTCCC
:::::.:::::::::::::: ::::::::::::::.:::::.::::::                                                    
TTTGAATATTTCAACACTGCACCTCTTGCACATGATCTGACGTTTAGA----------------------------------------------------
-F--E--Y--F--N--T--A--P--L--A--H--D--L--T--F--R-----------------------------------------------------

----------------------------------><----------------------------------------------------------------
P--S--M--S--V--A--A--S--E--Q--Q--E--D--M--A--R--P--P--Q--R--P--S--A--V--P--L--P--T--T--Q--A--L--A--L
CGTCGATGTCTGTGGCTGCATCAGAGCAGCAGGAGGACATGGCTCGGCCCCCGCAGAGGCCATCCGCTGTGCCGTTGCCCACCACGCAGGCCCTGGCTCT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

------------><--------------------------------------------------------------------------------------
--A--G--P--K--P--K--A--H--Q--F--S--I--K--S--F--S--S--P--T--Q--C--S--H--C--T--S--L--M--V--G--L--I--R-
GGCTGGACCGAAGCCAAAAGCTCACCAGTTCAGCATCAAGTCCTTCTCCAGCCCTACTCAGTGCAGCCACTGCACCTCCCTGATGGTTGGGCTGATCCGG
             ::.::::: ::::::::::::::::::::::::::::::::.:::::::::::::::::::::::::::::::: ::::::::::: 
-------------CCGAAAGCACACCAGTTCAGCATCAAGTCCTTCTCCAGCCCCACTCAGTGCAGCCACTGCACCTCCCTGATGGTGGGGCTGATCCGC
--------------P--K--A--H--Q--F--S--I--K--S--F--S--S--P--T--Q--C--S--H--C--T--S--L--M--V--G--L--I--R-

------------------><--------------------------------------------------------------------------------
-Q--G--Y--A--C--E--V--C--S--F--A--C--H--V--S--C--K--D--G--A--P--Q--V--C--P--I--P--P--E--Q--S--K--R--
CAGGGCTACGCCTGCGAGGTGTGTTCCTTTGCTTGCCACGTGTCCTGCAAAGACGGTGCCCCCCAGGTGTGCCCAATACCTCCCGAGCAGTCCAAGAGGC
::::::::::::::.      ::.:: ::.::.::::::::::::::::.::::.:.::.:::::::::::::: :: ::.::::::::::::::: :::
CAGGGCTACGCCTGT------TGCTCGTTCGCCTGCCACGTGTCCTGCAGAGACAGCGCTCCCCAGGTGTGCCCCATCCCCCCCGAGCAGTCCAAGCGGC
-Q--G--Y--A--C--------C--S--F--A--C--H--V--S--C--R--D--S--A--P--Q--V--C--P--I--P--P--E--Q--S--K--R--

-------------------------------------------------------><-------------------------------------------
P--L--G--V--D--V--Q--R--G--I--G--T--A--Y--K--G--H--V--K--V--P--K--P--T--G--V--K--K--G--W--Q--R--A--Y
CTCTGGGCGTGGACGTGCAGCGAGGCATCGGAACAGCCTACAAAGGCCATGTCAAGGTCCCAAAGCCCACGGGGGTGAAGAAGGGATGGCAGCGCGCATA
:.:::::::::::::::::: :.::::: ::.::.::::::::.:::.:.:: :::::::: ::::: :: :::::::::::::: :::::::: :: ::
CCCTGGGCGTGGACGTGCAGAGGGGCATAGGGACGGCCTACAAGGGCTACGTGAAGGTCCCCAAGCCGACCGGGGTGAAGAAGGGCTGGCAGCGGGCCTA
P--L--G--V--D--V--Q--R--G--I--G--T--A--Y--K--G--Y--V--K--V--P--K--P--T--G--V--K--K--G--W--Q--R--A--Y

-----------------------------------------------------------------------------------------------><---
--A--V--V--C--D--C--K--L--F--L--Y--D--L--P--E--G--K--S--T--Q--P--G--V--I--A--S--Q--V--L--D--L--R--D-
TGCAGTCGTCTGTGACTGCAAGCTCTTCCTGTATGATCTGCCTGAAGGAAAATCCACCCAGCCTGGTGTCATTGCGAGCCAAGTCTTGGATCTCAGAGAT
.::.:: ::::::::::::::::: ::.:: ::.::.:::::.::.:::::.::::: ::::::::.:::.: :: ::.::.::::::::::::   :::
CGCGGTGGTCTGTGACTGCAAGCTGTTTCTCTACGACCTGCCCGAGGGAAAGTCCACACAGCCTGGCGTCGTGGCCAGTCAGGTCTTGGATCTC---GAT
--A--V--V--C--D--C--K--L--F--L--Y--D--L--P--E--G--K--S--T--Q--P--G--V--V--A--S--Q--V--L--D--L-----D-

-----------------------------------------------------------------------------><---------------------
-D--E--F--S--V--S--S--V--L--A--S--D--V--I--H--A--T--R--R--D--I--P--C--I--F--R--V--T--A--S--L--L--G--
GACGAGTTTTCCGTGAGCTCAGTCCTGGCCTCAGATGTCATTCATGCTACACGCCGAGATATTCCATGTATATTCAGGGTGACGGCCTCTCTCTTAGGTG
:: :::::.::.:::::::::::::::::::::::.::::: ::.::  :.::::::::::::::.::::::::::::                      
GAAGAGTTCTCTGTGAGCTCAGTCCTGGCCTCAGACGTCATACACGCGTCGCGCCGAGATATTCCGTGTATATTCAGG----------------------
-E--E--F--S--V--S--S--V--L--A--S--D--V--I--H--A--S--R--R--D--I--P--C--I--F--R-----------------------

----------------------------------------------------------------------------------------------------
A--P--S--K--T--S--S--L--L--I--L--T--E--N--E--N--E--K--R--K--W--V--G--I--L--E--G--L--Q--S--I--L--H--K
CACCTTCTAAGACCAGCTCGCTGCTCATTCTGACAGAAAATGAGAATGAAAAGAGGAAGTGGGTTGGGATTCTAGAAGGACTCCAGTCCATCCTTCATAA
                                   :::::::::::.::.:::::::::::::::::::::::.::::: :: ::::::::::: :: ::
-----------------------------------GAAAATGAGAACGAGAAGAGGAAGTGGGTTGGGATTCTGGAAGGCCTGCAGTCCATCCTGCAGAA
------------------------------------E--N--E--N--E--K--R--K--W--V--G--I--L--E--G--L--Q--S--I--L--Q--K

----------------------------------------------------------------------------------------------><----
--N--R--L--R--N--Q--V--V--H--V--P--L--E--A--Y--D--S--S--L--P--L--I--K--A--I--L--T--A--A--I--V--D--A-
AAACCGGCTGAGGAATCAGGTCGTGCATGTTCCCTTGGAAGCCTACGACAGCTCGCTGCCTCTCATCAAGGCCATCCTGACAGCTGCCATCGTGGATGCA
.::::: :::::::..::::: :::::. ..:::. :::.:::::::::::::: :::::.::::::::::::.:::: .: ::.:::::: ::   ::.
GAACCGCCTGAGGAGCCAGGTGGTGCACTCCCCCCAGGAGGCCTACGACAGCTCCCTGCCCCTCATCAAGGCCGTCCTCGCCGCCGCCATCCTG---GCG
--N--R--L--R--S--Q--V--V--H--S--P--Q--E--A--Y--D--S--S--L--P--L--I--K--A--V--L--A--A--A--I--L-----A-

---------------------------------------------------------><-----------------------------------------
-D--R--I--A--V--G--L--E--E--G--L--Y--V--I--E--V--T--R--D--V--I--V--R--A--A--D--C--K--K--V--H--Q--I--
GACAGGATTGCAGTCGGCCTAGAAGAAGGGCTCTATGTCATAGAGGTCACCCGAGATGTGATCGTCCGTGCCGCTGACTGTAAGAAGGTACACCAGATCG
::::::::::: ::.:::::.::::::::::::::.:::.:.::::: ::::: :::                                           
GACAGGATTGCCGTTGGCCTGGAAGAAGGGCTCTACGTCGTGGAGGTGACCCGCGAT-------------------------------------------
-D--R--I--A--V--G--L--E--E--G--L--Y--V--V--E--V--T--R--D--------------------------------------------

----------------------------------------------------------------------------------------------------
E--L--A--P--R--E--K--I--V--I--L--L--C--G--R--N--H--H--V--H--L--Y--P--W--S--S--L--D--G--A--E--G--S--F
AGCTTGCTCCCAGGGAGAAGATCGTAATCCTCCTCTGTGGCCGGAACCACCATGTGCACCTCTATCCGTGGTCGTCCCTTGATGGAGCGGAAGGCAGCTT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--D--I--K--L--P--E--T--K--G--C--Q--L--M--A--T--A--T--L--K--R--N--S--G--T--C--L--F--V--A--V--K--R--L-
TGACATCAAGCTTCCGGAAACCAAAGGCTGCCAGCTCATGGCCACGGCCACACTCAAGAGGAACTCTGGCACCTGCCTGTTTGTGGCCGTGAAACGGCTG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-I--L--C--Y--E--I--Q--R--T--K--P--F--H--R--K--F--N--E--I--V--A--P--G--S--V--Q--C--L--A--V--L--R--D--
ATCCTTTGCTATGAGATCCAGAGAACGAAGCCATTCCACAGAAAGTTCAATGAGATTGTGGCTCCCGGCAGCGTGCAGTGCCTGGCGGTGCTCAGGGACA
                        :: ::::: ::::::::.:::.:::..::: :::.:::.::::::  .::::::::  :::: :::::::.:::::
------------------------ACTAAGCCTTTCCACAGGAAGCTCAGCGAGCTTGCGGCCCCCGGCCCTGTGCAGTGGATGGCCGTGCTCAAGGACA
-------------------------T--K--P--F--H--R--K--L--S--E--L--A--A--P--G--P--V--Q--W--M--A--V--L--K--D--

----------------------------------------------------------------------------------------------------
R--L--C--V--G--Y--P--S--G--F--C--L--L--S--I--Q--G--D--G--Q--P--L--N--L--V--N--P--N--D--P--S--L--A--F
GGCTCTGTGTGGGCTACCCTTCTGGGTTCTGCCTGCTGAGCATCCAGGGGGACGGGCAGCCTCTAAACCTGGTAAATCCCAATGACCCCTCGCTTGCGTT
.::::::::: ::::::::::::::::::: ::::.::::: .::::::.:: :::::: :::::::::::::::::::::::::::::::::::.::::
AGCTCTGTGTTGGCTACCCTTCTGGGTTCTCCCTGTTGAGCCCCCAGGGAGAGGGGCAGGCTCTAAACCTGGTAAATCCCAATGACCCCTCGCTTACGTT
K--L--C--V--G--Y--P--S--G--F--S--L--L--S--P--Q--G--E--G--Q--A--L--N--L--V--N--P--N--D--P--S--L--T--F

----------------------------------------------------------------------------------------------------
--L--S--Q--Q--S--F--D--A--L--C--A--V--E--L--E--S--E--E--Y--L--L--C--F--S--H--M--G--L--Y--V--D--P--Q-
CCTCTCACAACAGTCTTTTGATGCCCTTTGTGCTGTGGAGCTCGAAAGCGAGGAGTACCTGCTTTGCTTCAGCCACATGGGACTGTACGTGGACCCGCAA
:::::::::.:::::::::::::::::.::::::::::::::: ::::.:::::::::::::::::::::::::::::::::::::::::::::::.:::
CCTCTCACAGCAGTCTTTTGATGCCCTCTGTGCTGTGGAGCTCCAAAGTGAGGAGTACCTGCTTTGCTTCAGCCACATGGGACTGTACGTGGACCCACAA
--L--S--Q--Q--S--F--D--A--L--C--A--V--E--L--Q--S--E--E--Y--L--L--C--F--S--H--M--G--L--Y--V--D--P--Q-

------------------------------------------------------><--------------------------------------------
-G--R--R--A--R--A--Q--E--L--M--W--P--A--A--P--V--A--C--S--C--S--P--T--H--V--T--V--Y--S--E--Y--G--V--
GGCCGGAGGGCACGCGCGCAGGAGCTCATGTGGCCTGCGGCTCCTGTCGCCTGTAGTTGCAGCCCCACCCACGTCACGGTGTACAGCGAGTATGGCGTGG
::.:::::: :::::..:::::::::::::::::::::::: ::::::::::::   ::::::::: : ::::: :::::::::::::: ::.:::::::
GGTCGGAGGTCACGCATGCAGGAGCTCATGTGGCCTGCGGCACCTGTCGCCTGT---TGCAGCCCCTCGCACGTGACGGTGTACAGCGACTACGGCGTGG
-G--R--R--S--R--M--Q--E--L--M--W--P--A--A--P--V--A--C-----C--S--P--S--H--V--T--V--Y--S--D--Y--G--V--

----------------------------------------------------><----------------------------------------------
D--V--F--D--V--R--T--M--E--W--V--Q--T--I--G--L--R--R--I--R--P--L--N--S--E--G--T--L--N--L--L--N--C--E
ACGTCTTTGATGTGCGCACCATGGAGTGGGTGCAGACCATCGGCCTGCGGAGGATAAGGCCCCTGAACTCTGAAGGCACCCTCAACCTCCTCAACTGCGA
:::::::.::::.:::: ::::::::::::::::::::::::::::::: :::      :: :::::::: ::.:::: :::::::::::::::::::::
ACGTCTTCGATGCGCGCTCCATGGAGTGGGTGCAGACCATCGGCCTGCGCAGG------CCGCTGAACTCGGAGGGCAGCCTCAACCTCCTCAACTGCGA
D--V--F--D--A--R--S--M--E--W--V--Q--T--I--G--L--R--R--------P--L--N--S--E--G--S--L--N--L--L--N--C--E

-------------------------------------><-------------------------------------------------------------
--P--P--R--L--I--Y--F--K--S--K--F--S--G--A--V--L--N--V--P--D--T--S--D--N--S--K--K--Q--M--L--R--T--R-
GCCTCCACGCTTGATCTACTTCAAGAGCAAGTTCTCGGGAGCGGTTCTCAACGTGCCGGACACCTCCGACAACAGCAAGAAGCAGATGCTGCGCACCAGG
:::::: :::.: ::::::::::::::::::::: ::                                 :::::::::::::::::::: :::::::::
GCCTCCCCGCCTCATCTACTTCAAGAGCAAGTTCGCG---------------------------------AACAGCAAGAAGCAGATGCTTCGCACCAGG
--P--P--R--L--I--Y--F--K--S--K--F--A-----------------------------------N--S--K--K--Q--M--L--R--T--R-

-------------------------------------------------------><-------------------------------------------
-S--K--R--R--F--V--F--K--V--P--E--E--E--R--L--Q--Q--R--R--E--M--L--R--D--P--E--L--R--S--K--M--I--S--
AGCAAAAGGCGGTTCGTCTTCAAGGTCCCAGAGGAAGAGAGACTGCAGCAGAGGCGAGAGATGCTTAGAGACCCAGAATTGAGATCCAAAATGATATCCA
:::::.::::::::.::::::::::: ::.:::::.::: :.::::::::: ::   ::::::::.::::::::.::..::::.::  ..::::: ::::
AGCAAGAGGCGGTTTGTCTTCAAGGTGCCGGAGGAGGAGCGGCTGCAGCAGCGG---GAGATGCTCAGAGACCCGGAGCTGAGGTCGCGGATGATCTCCA
-S--K--R--R--F--V--F--K--V--P--E--E--E--R--L--Q--Q--R-----E--M--L--R--D--P--E--L--R--S--R--M--I--S--

-------------------------------------------------------------------------><-------------------------
N--P--T--N--F--N--H--V--A--H--M--G--P--G--D--G--M--Q--V--L--M--D--L--P--L--S--A--V--P--P--S--Q--E--E
ACCCAACCAACTTCAACCACGTGGCCCACATGGGCCCAGGCGACGGCATGCAGGTGCTCATGGACCTGCCTCTGAGTGCTGTGCCCCCCTCCCAGGAGGA
:::: :::::::::::.:::::::::::::::::::: ::::::::::::::::::::::::::::::::::::::.:::::::::::.:::::::::::
ACCCCACCAACTTCAATCACGTGGCCCACATGGGCCCCGGCGACGGCATGCAGGTGCTCATGGACCTGCCTCTGAGCGCTGTGCCCCCTTCCCAGGAGGA
N--P--T--N--F--N--H--V--A--H--M--G--P--G--D--G--M--Q--V--L--M--D--L--P--L--S--A--V--P--P--S--Q--E--E

-------------------------------------------------------------------------------><-------------------
--R--P--G--P--A--P--T--N--L--A--R--Q--P--P--S--R--N--K--P--Y--I--S--W--P--S--S--G--G--S--E--P--S--V-
AAGGCCGGGCCCCGCTCCCACCAACCTGGCTCGCCAGCCTCCATCCAGGAACAAGCCCTACATCTCGTGGCCCTCATCAGGTGGATCGGAGCCTAGCGTG
:::::: :::::.:::::..:::.:::: : ::.::::::::..:::::::::::::::::.:.:: :::::::::      :: :: :::::..: :::
AAGGCCCGGCCCTGCTCCTGCCAGCCTGTCGCGTCAGCCTCCGCCCAGGAACAAGCCCTACGTTTCCTGGCCCTCA------GGCTCTGAGCCCGGGGTG
--R--P--G--P--A--P--A--S--L--S--R--Q--P--P--P--R--N--K--P--Y--V--S--W--P--S--------G--S--E--P--G--V-

--------------------------------------------------><------------------------------------------------
-T--V--P--L--R--S--M--S--D--P--D--Q--D--F--D--K--E--P--D--S--D--S--T--K--H--S--T--P--S--N--S--S--N--
ACTGTGCCTCTGAGAAGTATGTCTGATCCAGACCAGGACTTTGACAAAGAGCCTGATTCGGACTCCACCAAACACTCAACTCCATCGAATAGCTCCAACC
.::::::::::::::::.::::::::::: :::::::::::::::::.:::::.:::::::::::::::::::::::.:::::::: ::.::::::::::
GCTGTGCCTCTGAGAAGCATGTCTGATCCCGACCAGGACTTTGACAAGGAGCCCGATTCGGACTCCACCAAACACTCGACTCCATCCAACAGCTCCAACC
-A--V--P--L--R--S--M--S--D--P--D--Q--D--F--D--K--E--P--D--S--D--S--T--K--H--S--T--P--S--N--S--S--N--

---------------------------------------------------------------------------------->
P--S--G--P--P--S--P--N--S--P--H--R--S--Q--L--P--L--E--G--L--E--Q--P--A--C--D--T--*-
CCAGCGGCCCACCGAGCCCCAACTCCCCCCACAGGAGCCAGCTCCCCCTCGAAGGCCTGGAGCAGCCGGCCTGTGACACCTGA
::::::::::.::::::::::::::.:::::::::::::::::::: ::::::::::::::::::::: :::.::::.:::::
CCAGCGGCCCGCCGAGCCCCAACTCTCCCCACAGGAGCCAGCTCCCGCTCGAAGGCCTGGAGCAGCCGTCCTATGACGCCTGA
P--S--G--P--P--S--P--N--S--P--H--R--S--Q--L--P--L--E--G--L--E--Q--P--S--Y--D--A--*-

Pig Consensus Sequence

>BGISUST0000900705
----------------------------------------------------------------------------------------------------
-----------------------------------------------------------------------------------------------GGGCC
CTGGCGCAACGAGAGCGCCCTGAGCGTGGAGACGCTGCTCGACGTGCTCGTCTGCCTGTACACCGAGTGCAGCCACTCGGCCCTGCGCCGCGACAAGTAT
GTGGCCGAGTTCCTCGAGTGG---AAACCATTTACACAGCTGGTGAAGGAAATGCAACTTCATCGAGAAGACTTCGAAATAATTAAAGTAATTGGAAGAG
GTGCTTTCGGCGAGGTCGCTGTGGTCAGGATGAAGAGCACCGAGCGCATCTACGCCATGAAGATTCTCAACAAGTGGGAGATGCTGAAGCGAGCAGAGAC
GGCTTGTTTCCGGGAGGAGCGGGACGTGCTGGTGAACGGCGACTCTCAGTGGCTCACCACGCTGCACTACGCCTTTCAGGATGAAAACTATCTGTACCTG
GTCATGGACTACTAAGTGGGCGGCGACCTGCTGACCCTGCTCAGCAAGTTCGAAGACCGGCTCCCGGAGGACATGGCGCGGTTCTACATCGGGGAGATGG
TGCTGGCCATCGACTCCATCCATCAGCTCCACTACGTGCAC---GACATTAAACCTGACAATGTCCTTTTGGATGTGAATGGTCATATCCGCCTGGCCGA
CTTTGGATCATGTTTGAAGATGAATGATGATGGAACTGTCCAGTCCTCCGTGGCCGTCGGCACCCCGGACTACATCTCCCCGGAGATCCTGCAGGCGATG
GAGGACGGCATGGGCAGGTACGGCCCCGAGTGCGACTGGTGGTCGCTGGGCGTCTGCATGTACGAGATGCTCTACGGAGAGACGCCGTTTTACGCCGAGT
CGCTGGTGGAGACCTACGGCAAGATCATGAAC--------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
---------------------------------------ACCCAGACCGTGCAGTCCTTCCACGGCGCAGCCCGGACCCTGGGCAGTGCCGCCCGTGACA
AAGAAATCAAAAAGCTCAACGAAGAAATTGAACGTTTGAAGAATAAAATAGCA-----------------------------------------------
----------------------------------------------------------------------------------------CAATTGATTGAA
GCTTCCGAGCGGCTGAAGTCCCAGGCCAGGGAACTGAAGGACGCCCACCAGCAGCGGAAGCTGGCCCTGCAGGAGTTCTCGGAGCTCAACGAGCGCATGG
CCGAGCTCCGCTCCCAGAAGCAGAAGGTGTCTCGGCAGCTGCGGGACCGAGAGGAGGAGGTGGNNGCGGCCTTGCAGAAGATCGACGCCCTGCGGCAGGA
GGTCCGCAGGGCCGACAAGTGCCGGAAGGAG---------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
---------------------------------------------------------------------------------------------CTTTGTG
CCTTTGTGGATAAGCTCACAGCTCAAAATAGGCAGTTGGAGGACGAGCTGCAGGATCTGGCGGCCAAGAAGGAGTCGGTTGCCCACTGGGAAGCCCAGAT
CGCAGAGATCATTCAG------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
--------CGGGCCAAGCAGCTCGTCCAGGAGGAGCTGAGGAAGGTCAAGGACATGAATCTCTCCTTCGAA---AAACTAAAGGATTCTGAAGCCAAAAA
TAGAGAATTATTAGAAGAAATGGAAATTTTGAAGAAGAAGATGGAAGAAAAATTTAGAACAGAT------CTCAAACTTCCAGATTTCCAGGATTCCATT
TTTGAATATTTCAACACTGCACCTCTTGCACATGATCTGACGTTTAGA----------------------------------------------------
----------------------------------------------------------------------------------------------------
-------------CCGAAAGCACACCAGTTCAGCATCAAGTCCTTCTCCAGCCCCACTCAGTGCAGCCACTGCACCTCCCTGATGGTGGGGCTGATCCGC
CAGGGCTACGCCTGT------TGCTCGTTCGCCTGCCACGTGTCCTGCAGAGACAGCGCTCCCCAGGTGTGCCCCATCCCCCCCGAGCAGTCCAAGCGGC
CCCTGGGCGTGGACGTGCAGAGGGGCATAGGGACGGCCTACAAGGGCTACGTGAAGGTCCCCAAGCCGACCGGGGTGAAGAAGGGCTGGCAGCGGGCCTA
CGCGGTGGTCTGTGACTGCAAGCTGTTTCTCTACGACCTGCCCGAGGGAAAGTCCACACAGCCTGGCGTCGTGGCCAGTCAGGTCTTGGATCTC---GAT
GAAGAGTTCTCTGTGAGCTCAGTCCTGGCCTCAGACGTCATACACGCGTCGCGCCGAGATATTCCGTGTATATTCAGG----------------------
-----------------------------------GAAAATGAGAACGAGAAGAGGAAGTGGGTTGGGATTCTGGAAGGCCTGCAGTCCATCCTGCAGAA
GAACCGCCTGAGGAGCCAGGTGGTGCACTCCCCCCAGGAGGCCTACGACAGCTCCCTGCCCCTCATCAAGGCCGTCCTCGCCGCCGCCATCCTG---GCG
GACAGGATTGCCGTTGGCCTGGAAGAAGGGCTCTACGTCGTGGAGGTGACCCGCGAT-------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
------------------------ACTAAGCCTTTCCACAGGAAGCTCAGCGAGCTTGCGGCCCCCGGCCCTGTGCAGTGGATGGCCGTGCTCAAGGACA
AGCTCTGTGTTGGCTACCCTTCTGGGTTCTCCCTGTTGAGCCCCCAGGGAGAGGGGCAGGCTCTAAACCTGGTAAATCCCAATGACCCCTCGCTTACGTT
CCTCTCACAGCAGTCTTTTGATGCCCTCTGTGCTGTGGAGCTCCAAAGTGAGGAGTACCTGCTTTGCTTCAGCCACATGGGACTGTACGTGGACCCACAA
GGTCGGAGGTCACGCATGCAGGAGCTCATGTGGCCTGCGGCACCTGTCGCCTGT---TGCAGCCCCTCGCACGTGACGGTGTACAGCGACTACGGCGTGG
ACGTCTTCGATGCGCGCTCCATGGAGTGGGTGCAGACCATCGGCCTGCGCAGG------CCGCTGAACTCGGAGGGCAGCCTCAACCTCCTCAACTGCGA
GCCTCCCCGCCTCATCTACTTCAAGAGCAAGTTCGCG---------------------------------AACAGCAAGAAGCAGATGCTTCGCACCAGG
AGCAAGAGGCGGTTTGTCTTCAAGGTGCCGGAGGAGGAGCGGCTGCAGCAGCGG---GAGATGCTCAGAGACCCGGAGCTGAGGTCGCGGATGATCTCCA
ACCCCACCAACTTCAATCACGTGGCCCACATGGGCCCCGGCGACGGCATGCAGGTGCTCATGGACCTGCCTCTGAGCGCTGTGCCCCCTTCCCAGGAGGA
AAGGCCCGGCCCTGCTCCTGCCAGCCTGTCGCGTCAGCCTCCGCCCAGGAACAAGCCCTACGTTTCCTGGCCCTCA------GGCTCTGAGCCCGGGGTG
GCTGTGCCTCTGAGAAGCATGTCTGATCCCGACCAGGACTTTGACAAGGAGCCCGATTCGGACTCCACCAAACACTCGACTCCATCCAACAGCTCCAACC
CCAGCGGCCCGCCGAGCCCCAACTCTCCCCACAGGAGCCAGCTCCCGCTCGAAGGCCTGGAGCAGCCGTCCTATGACGCCTGA


>BGISUSP0000900705
-----------------------------------------------------------------GPWRNESALSVETLLDVLVCLYTECSHSALRRDKY
VAEFLEW-KPFTQLVKEMQLHREDFEIIKVIGRGAFGEVAVVRMKSTERIYAMKILNKWEMLKRAETACFREERDVLVNGDSQWLTTLHYAFQDENYLYL
VMDY*VGGDLLTLLSKFEDRLPEDMARFYIGEMVLAIDSIHQLHYVH-DIKPDNVLLDVNGHIRLADFGSCLKMNDDGTVQSSVAVGTPDYISPEILQAM
EDGMGRYGPECDWWSLGVCMYEMLYGETPFYAESLVETYGKIMN--------------------------------------------------------
----------------------------------------------------------------------------------------------------
-------------TQTVQSFHGAARTLGSAARDKEIKKLNEEIERLKNKIA---------------------------------------------QLIE
ASERLKSQARELKDAHQQRKLALQEFSELNERMAELRSQKQKVSRQLRDREEEV-AALQKIDALRQEVRRADKCRKE-----------------------
----------------------------------------------------------------------------------------------------
-------------------------------LCAFVDKLTAQNRQLEDELQDLAAKKESVAHWEAQIAEIIQ----------------------------
------------------------------------RAKQLVQEELRKVKDMNLSFE-KLKDSEAKNRELLEEMEILKKKMEEKFRTD--LKLPDFQDSI
FEYFNTAPLAHDLTFR-------------------------------------------------------PKAHQFSIKSFSSPTQCSHCTSLMVGLIR
QGYAC--CSFACHVSCRDSAPQVCPIPPEQSKRPLGVDVQRGIGTAYKGYVKVPKPTGVKKGWQRAYAVVCDCKLFLYDLPEGKSTQPGVVASQVLDL-D
EEFSVSSVLASDVIHASRRDIPCIFR-------------------ENENEKRKWVGILEGLQSILQKNRLRSQVVHSPQEAYDSSLPLIKAVLAAAIL-A
DRIAVGLEEGLYVVEVTRD---------------------------------------------------------------------------------
--------TKPFHRKLSELAAPGPVQWMAVLKDKLCVGYPSGFSLLSPQGEGQALNLVNPNDPSLTFLSQQSFDALCAVELQSEEYLLCFSHMGLYVDPQ
GRRSRMQELMWPAAPVAC-CSPSHVTVYSDYGVDVFDARSMEWVQTIGLRR--PLNSEGSLNLLNCEPPRLIYFKSKFA-----------NSKKQMLRTR
SKRRFVFKVPEEERLQQR-EMLRDPELRSRMISNPTNFNHVAHMGPGDGMQVLMDLPLSAVPPSQEERPGPAPASLSRQPPPRNKPYVSWPS--GSEPGV
AVPLRSMSDPDQDFDKEPDSDSTKHSTPSNSSNPSGPPSPNSPHRSQLPLEGLEQPSYDA*