Sequences
EST Library Info
che1Heart - RNA from China
elu1Foetus 50 days, lung
fat1Fatt
hea4Heart
plun1Unavailable
sme1M. Semimembranosus
Clusters
Oligos
SNPs

Gene ID ENSG00000198873 (click for geneview)
Transcript ID ENST00000361993(link to ensembl)
Symbol GRK5
Localtion Chromosome:10:120957214:121205125:1 band: 10q26.11
Description G protein-coupled receptor kinase 5 (EC 2.7.1.-) (G protein-coupled receptor kinase GRK5). [Source:Uniprot/SWISSPROT;Acc:P34947]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<--------------------------------------------------><-----------------------------------------------
-M--E--L--E--N--I--V--A--N--T--V--L--L--K--A--R--E--G--G--G--G--K--R--K--G--K--S--K--K--W--K--E--I--
ATGGAGCTGGAAAACATCGTGGCCAACACGGTCTTGCTGAAAGCCAGGGAAGGGGGCGGAGGAAAGCGCAAAGGGAAAAGCAAGAAGTGGAAAGAAATCC
:::::::::::::::::::::::::::::::::::::::::::::::::::   ::::::::::::::::::::::::::::::::::::::.::.::::
ATGGAGCTGGAAAACATCGTGGCCAACACGGTCTTGCTGAAAGCCAGGGAA---GGCGGAGGAAAGCGCAAAGGGAAAAGCAAGAAGTGGAAGGAGATCC
-M--E--L--E--N--I--V--A--N--T--V--L--L--K--A--R--E-----G--G--G--K--R--K--G--K--S--K--K--W--K--E--I--

-----------------------------------------------><---------------------------------------------------
L--K--F--P--H--I--S--Q--C--E--D--L--R--R--T--I--D--R--D--Y--C--S--L--C--D--K--Q--P--I--G--R--L--L--F
TGAAGTTCCCTCACATTAGCCAGTGTGAAGACCTCCGAAGGACCATAGACAGAGATTACTGCAGTTTATGTGACAAGCAGCCAATCGGGAGGCTGCTTTT
::::::::::::::::.::::::::.:::::::::::.:::::: ::   :::::::::::::::::.::::::::.::::::::.::::::::::::::
TGAAGTTCCCTCACATCAGCCAGTGCGAAGACCTCCGGAGGACCCTA---AGAGATTACTGCAGTTTGTGTGACAAACAGCCAATTGGGAGGCTGCTTTT
L--K--F--P--H--I--S--Q--C--E--D--L--R--R--T--L-----R--D--Y--C--S--L--C--D--K--Q--P--I--G--R--L--L--F

------------------------------------------------------------><--------------------------------------
--R--Q--F--C--E--T--R--P--G--L--E--C--Y--I--Q--F--L--D--S--V--A--E--Y--E--V--T--P--D--E--K--L--G--E-
CCGGCAGTTTTGTGAAACCAGGCCTGGGCTGGAGTGTTACATTCAGTTCCTGGACTCCGTGGCAGAATATGAAGTTACTCCAGATGAAAAACTGGGAGAG
:::::::::.::.::::::::.::::::::::::: ::::::::::::::::::::: :::::::::::::::::::::::::::::::::::::::::.
CCGGCAGTTCTGCGAAACCAGACCTGGGCTGGAGTCTTACATTCAGTTCCTGGACTCAGTGGCAGAATATGAAGTTACTCCAGATGAAAAACTGGGAGAA
--R--Q--F--C--E--T--R--P--G--L--E--S--Y--I--Q--F--L--D--S--V--A--E--Y--E--V--T--P--D--E--K--L--G--E-

--------------------------------------><------------------------------------------------------------
-K--G--K--E--I--M--T--K--Y--L--T--P--K--S--P--V--F--I--A--Q--V--G--Q--D--L--V--S--Q--T--E--E--K--L--
AAAGGGAAGGAAATTATGACCAAGTACCTCACCCCAAAGTCCCCTGTTTTCATAGCCCAAGTTGGCCAAGACCTGGTCTCCCAGACGGAGGAGAAGCTCC
::.:::::.::.:::::::::::::::::::::::::::::.:: : :::::: ::::::::.:::::.:::::::::::::::.: :::::::::::::
AAGGGGAAAGAGATTATGACCAAGTACCTCACCCCAAAGTCTCCAGGTTTCATCGCCCAAGTCGGCCAGGACCTGGTCTCCCAGGCTGAGGAGAAGCTCC
-K--G--K--E--I--M--T--K--Y--L--T--P--K--S--P--G--F--I--A--Q--V--G--Q--D--L--V--S--Q--A--E--E--K--L--

---------------------------------------><-----------------------------------------------------------
L--Q--K--P--C--K--E--L--F--S--A--C--A--Q--S--V--H--E--Y--L--R--G--E--P--F--H--E--Y--L--D--S--M--F--F
TACAGAAGCCGTGCAAAGAACTCTTTTCTGCCTGTGCACAGTCTGTCCACGAGTACCTGAGGGGAGAACCATTCCACGAATATCTGGACAGCATGTTTTT
: :::::.:: :::::::::::::::::..::::.      ::.::::::::.:::::: ::::::.::: ::::::::.::.::::::::::::: :::
TCCAGAAACCCTGCAAAGAACTCTTTTCCACCTGC------TCCGTCCACGAATACCTGCGGGGAGGACCCTTCCACGAGTACCTGGACAGCATGTATTT
L--Q--K--P--C--K--E--L--F--S--T--C--------S--V--H--E--Y--L--R--G--G--P--F--H--E--Y--L--D--S--M--Y--F

--------------------------------><--------------------------------------------------------------><--
--D--R--F--L--Q--W--K--W--L--E--R--Q--P--V--T--K--N--T--F--R--Q--Y--R--V--L--G--K--G--G--F--G--E--V-
TGACCGCTTTCTCCAGTGGAAGTGGTTGGAAAGGCAACCGGTGACCAAAAACACTTTCAGGCAGTATCGAGTGCTAGGAAAAGGGGGCTTCGGGGAGGTC
:::.:::::::::::::::::::::::::::                                                                  :::
TGATCGCTTTCTCCAGTGGAAGTGGTTGGAA------------------------------------------------------------------GTC
--D--R--F--L--Q--W--K--W--L--E--------------------------------------------------------------------V-

----------------------------------------------------------------------------------------------------
-C--A--C--Q--V--R--A--T--G--K--M--Y--A--C--K--R--L--E--K--K--R--I--K--K--R--K--G--E--S--M--A--L--N--
TGTGCCTGCCAGGTTCGGGCCACGGGTAAAATGTATGCCTGCAAGCGCTTGGAGAAGAAGAGGATCAAAAAGAGGAAAGGGGAGTCCATGGCCCTCAATG
:::::::::::::::::::::::::::::::::::.:::::.::::::.:::::::::::::::::::::::::::::::::::::::::::.:: ::::
TGTGCCTGCCAGGTTCGGGCCACGGGTAAAATGTACGCCTGTAAGCGCCTGGAGAAGAAGAGGATCAAAAAGAGGAAAGGGGAGTCCATGGCTCTGAATG
-C--A--C--Q--V--R--A--T--G--K--M--Y--A--C--K--R--L--E--K--K--R--I--K--K--R--K--G--E--S--M--A--L--N--

-------------------------------------><-------------------------------------------------------------
E--K--Q--I--L--E--K--V--N--S--Q--F--V--V--N--L--A--Y--A--Y--E--T--K--D--A--L--C--L--V--L--T--I--M--N
AGAAGCAGATCCTCGAGAAGGTCAACAGTCAGTTTGTGGTCAACCTGGCCTATGCCTACGAGACCAAGGATGCACTGTGCTTGGTCCTGACCATCATGAA
:::::::.::::: ::::::::::::::::::::::::::::::::::::::.:::::::::::::::::.::.::::::::::::::::::::::::::
AGAAGCAAATCCTGGAGAAGGTCAACAGTCAGTTTGTGGTCAACCTGGCCTACGCCTACGAGACCAAGGACGCGCTGTGCTTGGTCCTGACCATCATGAA
E--K--Q--I--L--E--K--V--N--S--Q--F--V--V--N--L--A--Y--A--Y--E--T--K--D--A--L--C--L--V--L--T--I--M--N

----------------------------------------------------------------------------------------------------
--G--G--D--L--K--F--H--I--Y--N--M--G--N--P--G--F--E--E--E--R--A--L--F--Y--A--A--E--I--L--C--G--L--E-
TGGGGGTGACCTGAAGTTCCACATCTACAACATGGGCAACCCTGGCTTCGAGGAGGAGCGGGCCTTGTTTTATGCGGCAGAGATCCTCTGCGGCTTAGAA
:::::: ::::::::::::::::::::::::::::: ::::::::::::::::::::::: :::.: ::.::.:::::.:::::::: ::::::::.:::
TGGGGGGGACCTGAAGTTCCACATCTACAACATGGGGAACCCTGGCTTCGAGGAGGAGCGCGCCCTCTTCTACGCGGCGGAGATCCTGTGCGGCTTGGAA
--G--G--D--L--K--F--H--I--Y--N--M--G--N--P--G--F--E--E--E--R--A--L--F--Y--A--A--E--I--L--C--G--L--E-

----------------------------><------------------------------------><--------------------------------
-D--L--H--R--E--N--T--V--Y--R--D--L--K--P--E--N--I--L--L--D--D--Y--G--H--I--R--I--S--D--L--G--L--A--
GACCTCCACCGTGAGAACACCGTCTACCGAGATCTGAAACCTGAAAACATCCTGTTAGATGATTATGGCCACATTAGGATCTCAGACCTGGGCTTGGCTG
::::: :::::.:::::::::::::::                                          ::::::::::::::.:::::::::.::::::
GACCTGCACCGCGAGAACACCGTCTAC------------------------------------------CACATTAGGATCTCGGACCTGGGCCTGGCTG
-D--L--H--R--E--N--T--V--Y--------------------------------------------H--I--R--I--S--D--L--G--L--A--

--------------------------------------------------------><------------------------------------------
V--K--I--P--E--G--D--L--I--R--G--R--V--G--T--V--G--Y--M--A--P--E--V--L--N--N--Q--R--Y--G--L--S--P--D
TGAAGATCCCCGAGGGAGACCTGATCCGCGGCCGGGTGGGCACTGTTGGCTACATGGCTCCAGAGGTCCTGAACAACCAGAGGTACGGCCTGAGCCCCGA
:::::::::::::::: ::::::::::: ::::::::::::::.::.:::::::::   ::.:::::::::::::::::::::::.:::::::::::.::
TGAAGATCCCCGAGGGCGACCTGATCCGAGGCCGGGTGGGCACCGTCGGCTACATG---CCGGAGGTCCTGAACAACCAGAGGTATGGCCTGAGCCCTGA
V--K--I--P--E--G--D--L--I--R--G--R--V--G--T--V--G--Y--M-----P--E--V--L--N--N--Q--R--Y--G--L--S--P--D

----------------------------------------------------------------------------------------------------
--Y--W--G--L--G--C--L--I--Y--E--M--I--E--G--Q--S--P--F--R--G--R--K--E--K--V--K--R--E--E--V--D-----R-
CTACTGGGGCCTTGGCTGCCTCATCTATGAGATGATCGAGGGCCAGTCGCCGTTCCGCGGCCGCAAGGAGAAGGTGAAGCGGGAGGAGGTGGAC---CGC
:::::::::::: ::::::::::::::.::::::::::::::::::::::: ::::::::::::::::::::::::::: ::::::::::::::   .::
CTACTGGGGCCTGGGCTGCCTCATCTACGAGATGATCGAGGGCCAGTCGCCCTTCCGCGGCCGCAAGGAGAAGGTGAAGAGGGAGGAGGTGGACC--TGC
--Y--W--G--L--G--C--L--I--Y--E--M--I--E--G--Q--S--P--F--R--G--R--K--E--K--V--K--R--E--E--V--D--\--R-

--------------------------------------------------------------------><------------------------------
-R--V--L--E--T--E--E--V--Y--S--H--K--F--S--E--E--A--K--S--I--C--K--M--L--L--T--K--D--A--K--Q--R--L--
CGGGTCCTGGAGACGGAGGAGGTGTACTCCCACAAGTTCTCCGAGGAGGCCAAGTCCATCTGCAAGATGCTGCTCACGAAAGATGCGAAGCAGAGGCTGG
::::::::::::::::::::::::::::: :::::::::::::::::::::::::::::::::::.::::::::::: ::::::::.:::::::::::::
CGGGTCCTGGAGACGGAGGAGGTGTACTCGCACAAGTTCTCCGAGGAGGCCAAGTCCATCTGCAAAATGCTGCTCACCAAAGATGCAAAGCAGAGGCTGG
-R--V--L--E--T--E--E--V--Y--S--H--K--F--S--E--E--A--K--S--I--C--K--M--L--L--T--K--D--A--K--Q--R--L--

----------------------------------------------------------------------------------------------------
G--C--Q--E--E--G--A--A--E--V--K--R--H--P--F--F--R--N--M--N--F--K--R--L--E--A--G--M--L--D--P--P--F--V
GCTGCCAGGAGGAGGGGGCTGCAGAGGTCAAGAGACACCCCTTCTTCAGGAACATGAACTTCAAGCGCTTAGAAGCCGGGATGTTGGACCCTCCCTTCGT
:::::::::::::::::::::::::::::::.::::::::::::::::::::::::::.:::::::::::::::::.:::::::::::.::::::::.::
GCTGCCAGGAGGAGGGGGCTGCAGAGGTCAAAAGACACCCCTTCTTCAGGAACATGAATTTCAAGCGCTTAGAAGCTGGGATGTTGGATCCTCCCTTTGT
G--C--Q--E--E--G--A--A--E--V--K--R--H--P--F--F--R--N--M--N--F--K--R--L--E--A--G--M--L--D--P--P--F--V

------><--------------------------------------------------------------------------------------------
--P--D--P--R--A--V--Y--C--K--D--V--L--D--I--E--Q--F--S--T--V--K--G--V--N--L--D--H--T--D--D--D--F--Y-
TCCAGACCCCCGCGCTGTGTACTGTAAGGACGTGCTGGACATCGAGCAGTTCTCCACTGTGAAGGGCGTCAATCTGGACCACACAGACGACGACTTCTAC
:::.   ::::: ::.::::::::.:::::.::::::::::::::::::::::::::::: :::::::::::.:::::::::::.:::::::::::::::
TCCG---CCCCGGGCCGTGTACTGCAAGGATGTGCTGGACATCGAGCAGTTCTCCACTGTCAAGGGCGTCAACCTGGACCACACGGACGACGACTTCTAC
--P-----P--R--A--V--Y--C--K--D--V--L--D--I--E--Q--F--S--T--V--K--G--V--N--L--D--H--T--D--D--D--F--Y-

--------------------------------------------><------------------------------------------------------
-S--K--F--S--T--G--S--V--S--I--P--W--Q--N--E--M--I--E--T--E--C--F--K--E--L--N--V--F--G--P--N--G--T--
TCCAAGTTCTCCACGGGCTCTGTGTCCATCCCATGGCAAAACGAGATGATAGAAACAGAATGCTTTAAGGAGCTGAACGTGTTTGGACCTAATGGTACCC
::::::::::::::::::::.:::.:::::::.:::::.:.:::::::::::::::.::.::::::::::::::::::::::::::::::::.:::::::
TCCAAGTTCTCCACGGGCTCCGTGCCCATCCCGTGGCAGAGCGAGATGATAGAAACGGAGTGCTTTAAGGAGCTGAACGTGTTTGGACCTAACGGTACCC
-S--K--F--S--T--G--S--V--P--I--P--W--Q--S--E--M--I--E--T--E--C--F--K--E--L--N--V--F--G--P--N--G--T--

----------------------------------------------------------------------------><----------------------
L--P--P--D--L--N--R--N--H--P--P--E--P--P--K--K--G--L--L--Q--R--L--F--K--R--Q--H--Q--N--N--S--K--S--S
TCCCGCCAGATCTGAACAGAAACCACCCTCCGGAACCGCCCAAGAAAGGGCTGCTCCAGAGACTCTTCAAGCGGCAGCATCAGAACAATTCCAAGAGTTC
::.:.::.::.::::::::::.:::::::::::::::.:: ::::::::::::::::: ::.::::::::::: ::::::::::::::::::::::::::
TCTCACCGGACCTGAACAGAAGCCACCCTCCGGAACCACCGAAGAAAGGGCTGCTCCACAGGCTCTTCAAGCGTCAGCATCAGAACAATTCCAAGAGTTC
L--S--P--D--L--N--R--S--H--P--P--E--P--P--K--K--G--L--L--H--R--L--F--K--R--Q--H--Q--N--N--S--K--S--S

--------------------------------------------------------------------------->
--P--S--S--K--T--S--F--N--H--H--I--N--S--N--H--V--S--S--N--S--T--G--S--S--*-
GCCCAGCTCCAAGACCAGTTTTAACCACCACATAAACTCAAACCATGTCAGCTCGAACTCCACCGGAAGCAGCTAG
.::::.:::::::.:::::::::::: :::::::::.:::::.::::::::.::.:::::::::::.:::::::::
ACCCAACTCCAAGGCCAGTTTTAACCCCCACATAAATTCAAATCATGTCAGTTCAAACTCCACCGGGAGCAGCTAG
--P--N--S--K--A--S--F--N--P--H--I--N--S--N--H--V--S--S--N--S--T--G--S--S--*-

Pig Consensus Sequence

>BGISUST0000888566
ATGGAGCTGGAAAACATCGTGGCCAACACGGTCTTGCTGAAAGCCAGGGAA---GGCGGAGGAAAGCGCAAAGGGAAAAGCAAGAAGTGGAAGGAGATCC
TGAAGTTCCCTCACATCAGCCAGTGCGAAGACCTCCGGAGGACCCTA---AGAGATTACTGCAGTTTGTGTGACAAACAGCCAATTGGGAGGCTGCTTTT
CCGGCAGTTCTGCGAAACCAGACCTGGGCTGGAGTCTTACATTCAGTTCCTGGACTCAGTGGCAGAATATGAAGTTACTCCAGATGAAAAACTGGGAGAA
AAGGGGAAAGAGATTATGACCAAGTACCTCACCCCAAAGTCTCCAGGTTTCATCGCCCAAGTCGGCCAGGACCTGGTCTCCCAGGCTGAGGAGAAGCTCC
TCCAGAAACCCTGCAAAGAACTCTTTTCCACCTGC------TCCGTCCACGAATACCTGCGGGGAGGACCCTTCCACGAGTACCTGGACAGCATGTATTT
TGATCGCTTTCTCCAGTGGAAGTGGTTGGAA------------------------------------------------------------------GTC
TGTGCCTGCCAGGTTCGGGCCACGGGTAAAATGTACGCCTGTAAGCGCCTGGAGAAGAAGAGGATCAAAAAGAGGAAAGGGGAGTCCATGGCTCTGAATG
AGAAGCAAATCCTGGAGAAGGTCAACAGTCAGTTTGTGGTCAACCTGGCCTACGCCTACGAGACCAAGGACGCGCTGTGCTTGGTCCTGACCATCATGAA
TGGGGGGGACCTGAAGTTCCACATCTACAACATGGGGAACCCTGGCTTCGAGGAGGAGCGCGCCCTCTTCTACGCGGCGGAGATCCTGTGCGGCTTGGAA
GACCTGCACCGCGAGAACACCGTCTAC------------------------------------------CACATTAGGATCTCGGACCTGGGCCTGGCTG
TGAAGATCCCCGAGGGCGACCTGATCCGAGGCCGGGTGGGCACCGTCGGCTACATG---CCGGAGGTCCTGAACAACCAGAGGTATGGCCTGAGCCCTGA
CTACTGGGGCCTGGGCTGCCTCATCTACGAGATGATCGAGGGCCAGTCGCCCTTCCGCGGCCGCAAGGAGAAGGTGAAGAGGGAGGAGGTGGActGCCGG
GTCCTGGAGACGGAGGAGGTGTACTCGCACAAGTTCTCCGAGGAGGCCAAGTCCATCTGCAAAATGCTGCTCACCAAAGATGCAAAGCAGAGGCTGGGCT
GCCAGGAGGAGGGGGCTGCAGAGGTCAAAAGACACCCCTTCTTCAGGAACATGAATTTCAAGCGCTTAGAAGCTGGGATGTTGGATCCTCCCTTTGTTCC
G---CCCCGGGCCGTGTACTGCAAGGATGTGCTGGACATCGAGCAGTTCTCCACTGTCAAGGGCGTCAACCTGGACCACACGGACGACGACTTCTACTCC
AAGTTCTCCACGGGCTCCGTGCCCATCCCGTGGCAGAGCGAGATGATAGAAACGGAGTGCTTTAAGGAGCTGAACGTGTTTGGACCTAACGGTACCCTCT
CACCGGACCTGAACAGAAGCCACCCTCCGGAACCACCGAAGAAAGGGCTGCTCCACAGGCTCTTCAAGCGTCAGCATCAGAACAATTCCAAGAGTTCACC
CAACTCCAAGGCCAGTTTTAACCCCCACATAAATTCAAATCATGTCAGTTCAAACTCCACCGGGAGCAGCTAG


>BGISUSP0000888566
MELENIVANTVLLKARE-GGGKRKGKSKKWKEILKFPHISQCEDLRRTL-RDYCSLCDKQPIGRLLFRQFCETRPGLESYIQFLDSVAEYEVTPDEKLGE
KGKEIMTKYLTPKSPGFIAQVGQDLVSQAEEKLLQKPCKELFSTC--SVHEYLRGGPFHEYLDSMYFDRFLQWKWLE----------------------V
CACQVRATGKMYACKRLEKKRIKKRKGESMALNEKQILEKVNSQFVVNLAYAYETKDALCLVLTIMNGGDLKFHIYNMGNPGFEEERALFYAAEILCGLE
DLHRENTVY--------------HIRISDLGLAVKIPEGDLIRGRVGTVGYM-PEVLNNQRYGLSPDYWGLGCLIYEMIEGQSPFRGRKEKVKREEVDCR
VLETEEVYSHKFSEEAKSICKMLLTKDAKQRLGCQEEGAAEVKRHPFFRNMNFKRLEAGMLDPPFVP-PRAVYCKDVLDIEQFSTVKGVNLDHTDDDFYS
KFSTGSVPIPWQSEMIETECFKELNVFGPNGTLSPDLNRSHPPEPPKKGLLHRLFKRQHQNNSKSSPNSKASFNPHINSNHVSSNSTGSS*