Sequences
EST Library Info
cad1Unavailable
cki1Kidney - RNA from China
ecc1Foetus 50 days, cortex cerebri
fbs1Unavailable
fhi1Unavailable
jej1Small intestine, jejunum
med1Mediastinum
nco2Newborn 115 days, colon
nep1Newborn 115 days, epidermis
nje4Newborn 115 days, jejunum
nlu1Newborn 115 days, lung
pgl1Pituitary gland
pigcb2Unavailable
plac2Unavailable
plun1Unavailable
spl1Spleen
tes1Testes
Clusters
Oligos
SNPs

Gene ID ENSG00000179918 (click for geneview)
Transcript ID ENST00000361995(link to ensembl)
Symbol SEPHS2
Localtion Chromosome:16:30363203:30364549:-1 band: 16p11.2
Description Selenide, water dikinase 2 (EC 2.7.9.3) (Selenophosphate synthetase 2) (Selenium donor protein 2). [Source:Uniprot/SWISSPROT;Acc:Q99611]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--A--E--A--S--A--T--G--A--C--G--E--A--M--A--A--A-----------E--G--S--S--G--P--A--G--L--T--L--G--R--
ATGGCGGAAGCCTCGGCGACGGGCGCCTGCGGAGAGGCGATGGCAGCGGCG---------GAAGGCTCCTCGGGCCCGGCGGGCTTGACTCTGGGCCGGA
:::::::::::: :::::::::::::: ::::::::..::::::.::::.:         ::::::: ::::::::::::::::::: ::::.::.:::.
ATGGCGGAAGCCGCGGCGACGGGCGCCGGCGGAGAGATGATGGCGGCGGTGGCGGCGGGTGAAGGCTGCTCGGGCCCGGCGGGCTTGTCTCTAGGTCGGG
-M--A--E--A--A--A--T--G--A--G--G--E--M--M--A--A--V--A--A--G--E--G--C--S--G--P--A--G--L--S--L--G--R--

----------------------------------------------------------------------------------------------------
S--F--S--N--Y--R--P--F--E--P--Q--A--L--G--L--S--P--S--W--R--L--T--G--F--S--G--M--K--G--*--G--C--K--V
GCTTCTCGAACTACCGGCCCTTCGAGCCCCAGGCGTTGGGCCTCAGCCCGAGCTGGCGGCTGACGGGCTTCTCCGGCATGAAGGGCTGAGGCTGCAAGGT
::::::::..::::::::::::::::::::::::::::::::: :::::::::::::::::::: ::::::::.:::::::::::::::::::::::.::
GCTTCTCGGGCTACCGGCCCTTCGAGCCCCAGGCGTTGGGCCTGAGCCCGAGCTGGCGGCTGACTGGCTTCTCTGGCATGAAGGGCTGAGGCTGCAAAGT
G--F--S--G--Y--R--P--F--E--P--Q--A--L--G--L--S--P--S--W--R--L--T--G--F--S--G--M--K--G--*--G--C--K--V

----------------------------------------------------------------------------------------------------
--P--Q--E--A--L--L--K--L--L--A--G--L--T--R--P--D--V--R--P--P--L--G--R--G--L--V--G--G--Q--E--E--A--S-
CCCGCAGGAGGCGCTGCTCAAACTCCTGGCGGGACTGACGCGGCCGGACGTGCGGCCCCCGCTGGGCCGGGGCCTGGTGGGTGGCCAGGAAGAGGCGTCC
::: ::::::.::::::::::::::::::::::::::::::::::::: :::::::::::  :::::::::::::::: :: ::::  ::::::::: ::
CCCCCAGGAGACGCTGCTCAAACTCCTGGCGGGACTGACGCGGCCGGAGGTGCGGCCCCCCGTGGGCCGGGGCCTGGTCGGAGGCCTTGAAGAGGCGGCC
--P--Q--E--T--L--L--K--L--L--A--G--L--T--R--P--E--V--R--P--P--V--G--R--G--L--V--G--G--L--E--E--A--A-

----------------------------------------------------------------------------------------------------
-Q--E--A--G--L--P--A--G--A--G--P--S--P--T--F--P--A--L--G--I--G--M--D--S--C--V--I--P--L--R--H--G--G--
CAGGAAGCCGGCCTGCCGGCAGGAGCGGGCCCCAGCCCCACCTTTCCAGCCCTGGGCATCGGGATGGACTCCTGCGTCATCCCCCTGAGGCACGGGGGCC
:::::::::::::::::::...:.::::. :::::::: :::::.:::.:::: :::::.::  ::::::::::::::::::::::::::::::::::::
CAGGAAGCCGGCCTGCCGGTGAGGGCGGAACCCAGCCCAACCTTCCCAACCCTCGGCATTGGCCTGGACTCCTGCGTCATCCCCCTGAGGCACGGGGGCC
-Q--E--A--G--L--P--V--R--A--E--P--S--P--T--F--P--T--L--G--I--G--L--D--S--C--V--I--P--L--R--H--G--G--

----------------------------------------------------------------------------------------------------
L--S--L--V--Q--T--T--D--F--F--Y--P--L--V--E--D--P--Y--M--M--G--R--I--A--C--A--N--V--L--S--D--L--Y--A
TGTCACTGGTGCAGACCACGGACTTCTTTTACCCCTTGGTAGAAGATCCCTACATGATGGGGCGCATAGCTTGTGCCAACGTGCTGAGTGACCTCTACGC
:::: :: :::::::::::::::::.::.:::::::::::.:::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
TGTCCCTTGTGCAGACCACGGACTTTTTCTACCCCTTGGTGGAAGATCCCTACATGATGGGGCGCATAGCTTGTGCCAACGTGCTGAGTGACCTCTACGC
L--S--L--V--Q--T--T--D--F--F--Y--P--L--V--E--D--P--Y--M--M--G--R--I--A--C--A--N--V--L--S--D--L--Y--A

----------------------------------------------------------------------------------------------------
--M--G--I--T--E--C--D--N--M--L--M--L--L--S--V--S--Q--S--M--S--E--E--E--R--E--K--V--T--P--L--M--V--K-
CATGGGGATTACTGAGTGTGACAACATGTTGATGTTACTCAGCGTCAGCCAGAGTATGAGTGAGGAGGAACGCGAAAAGGTAACGCCACTCATGGTCAAA
:::::: :::::::::::::::::::::::::::.: ::::::::::::::::.::::: :::::::::::: ::.::..:::: :: ::::::.:::::
CATGGGCATTACTGAGTGTGACAACATGTTGATGCTCCTCAGCGTCAGCCAGAATATGATTGAGGAGGAACGAGAGAAAATAACCCCCCTCATGATCAAA
--M--G--I--T--E--C--D--N--M--L--M--L--L--S--V--S--Q--N--M--I--E--E--E--R--E--K--I--T--P--L--M--I--K-

----------------------------------------------------------------------------------------------------
-G--F--R--D--A--A--E--E--G--G--T--A--V--T--G--G--Q--T--V--V--N--P--W--I--I--I--G--G--V--A--T--V--V--
GGCTTTCGGGATGCGGCTGAGGAAGGAGGGACGGCAGTGACCGGTGGGCAAACGGTGGTCAACCCTTGGATTATAATCGGTGGAGTTGCCACTGTAGTAT
:::::::::::::: :: :::::::::::::: ::::::::.::.:::::.::::::.: :::::::::::::: :::::.::::: ::::::::.:: :
GGCTTTCGGGATGCCGCGGAGGAAGGAGGGACTGCAGTGACTGGCGGGCAGACGGTGATAAACCCTTGGATTATCATCGGCGGAGTGGCCACTGTGGTCT
-G--F--R--D--A--A--E--E--G--G--T--A--V--T--G--G--Q--T--V--I--N--P--W--I--I--I--G--G--V--A--T--V--V--

----------------------------------------------------------------------------------------------------
C--Q--P--N--E--F--I--M--P--D--S--A--V--V--G--D--V--L--V--L--T--K--P--L--G--T--Q--V--A--V--N--A--H--Q
GCCAACCAAATGAGTTCATAATGCCGGACAGCGCCGTCGTTGGGGACGTGCTGGTGTTAACCAAACCGTTAGGAACCCAGGTTGCTGTCAATGCCCACCA
:.::.::::::::.::::: ::::: :::::.:::::.::::::::.:::::::::::::::::::: .::::::::::.::.::.::::::::::::::
GTCAGCCAAATGAATTCATTATGCCCGACAGTGCCGTTGTTGGGGATGTGCTGGTGTTAACCAAACCCCTAGGAACCCAAGTCGCCGTCAATGCCCACCA
C--Q--P--N--E--F--I--M--P--D--S--A--V--V--G--D--V--L--V--L--T--K--P--L--G--T--Q--V--A--V--N--A--H--Q

----------------------------------------------------------------------------------------------------
--W--L--D--N--P--E--R--W--N--K--V--K--M--V--V--S--R--E--E--V--E--L--A--Y--Q--E--A--M--F--N--M--A--T-
ATGGCTGGATAATCCTGAAAGATGGAATAAAGTAAAGATGGTGGTCTCCAGAGAAGAGGTGGAGCTGGCCTATCAGGAAGCCATGTTCAATATGGCTACC
::::::::::::::::::::::::::::::..:::::::::: ::::: :::::::::::.:::::::::::::::::::::::::::::.::::::::.
ATGGCTGGATAATCCTGAAAGATGGAATAAGATAAAGATGGTCGTCTCAAGAGAAGAGGTAGAGCTGGCCTATCAGGAAGCCATGTTCAACATGGCTACT
--W--L--D--N--P--E--R--W--N--K--I--K--M--V--V--S--R--E--E--V--E--L--A--Y--Q--E--A--M--F--N--M--A--T-

----------------------------------------------------------------------------------------------------
-L--N--R--T--A--A--G--L--M--H--T--F--N--A--H--A--A--T--D--I--T--G--F--G--I--L--G--H--S--Q--N--L--A--
CTCAACAGAACTGCTGCAGGTTTAATGCACACATTTAATGCCCATGCGGCCACAGATATCACAGGCTTTGGCATTCTAGGACACTCCCAGAACCTTGCAA
:: ::.:::::.::::: ::.::.::::::::.:::::::::::.::.::::::::::::::.::::::::::::::.:::::::: :::::::::::::
CTAAATAGAACCGCTGCTGGCTTGATGCACACGTTTAATGCCCACGCAGCCACAGATATCACGGGCTTTGGCATTCTGGGACACTCGCAGAACCTTGCAA
-L--N--R--T--A--A--G--L--M--H--T--F--N--A--H--A--A--T--D--I--T--G--F--G--I--L--G--H--S--Q--N--L--A--

----------------------------------------------------------------------------------------------------
K--Q--Q--R--N--E--V--S--F--V--I--H--N--L--P--I--I--A--K--M--A--A--V--S--K--A--S--G--R--F--G--L--L--Q
AACAACAAAGAAATGAAGTGTCCTTTGTTATTCATAATCTGCCAATAATTGCCAAGATGGCTGCCGTCAGCAAGGCCAGTGGACGGTTTGGGCTTCTTCA
:::::::.::::::::.:::::::::::.::::::::::::::.:: ::.:::::::::::::::.:::::::::::::.:: :: ::::::::.:::::
AACAACAGAGAAATGAGGTGTCCTTTGTCATTCATAATCTGCCGATCATCGCCAAGATGGCTGCCATCAGCAAGGCCAGCGGCCGCTTTGGGCTCCTTCA
K--Q--Q--R--N--E--V--S--F--V--I--H--N--L--P--I--I--A--K--M--A--A--I--S--K--A--S--G--R--F--G--L--L--Q

----------------------------------------------------------------------------------------------------
--G--T--S--A--E--T--S--G--G--L--L--I--C--L--P--R--E--Q--A--A--R--F--C--S--E--I--K--S--S--K--Y--G--E-
AGGAACCTCAGCTGAAACCTCTGGGGGATTACTGATTTGTCTGCCAAGAGAACAGGCGGCTCGCTTTTGTTCTGAAATCAAATCCTCCAAGTACGGAGAG
.:::::::: :: :::::.::::::::.::::::::::::::::::::.::.::.::.:::::::::::::: :::::::::::.:: ::::::::::::
GGGAACCTCCGCAGAAACTTCTGGGGGGTTACTGATTTGTCTGCCAAGGGAGCAAGCAGCTCGCTTTTGTTCAGAAATCAAATCTTCAAAGTACGGAGAG
--G--T--S--A--E--T--S--G--G--L--L--I--C--L--P--R--E--Q--A--A--R--F--C--S--E--I--K--S--S--K--Y--G--E-

----------------------------------------------------------------------------------------------------
-G--H--Q--A--W--I--V--G--I--V--E--K--G--N--R--T--A--R--I--I--D--K--P--R--V--I--E--V--L--P--R--G--A--
GGTCACCAAGCGTGGATCGTTGGCATTGTGGAAAAGGGAAACCGAACGGCCCGGATCATTGACAAGCCGCGAGTTATTGAAGTCCTGCCTCGTGGGGCCA
::::::::::: :::::::: :::::::::::::::::::::::.::.:::::::::::::::::::: :::::::::::.:::::.:::::::::.::.
GGTCACCAAGCCTGGATCGTGGGCATTGTGGAAAAGGGAAACCGGACAGCCCGGATCATTGACAAGCCTCGAGTTATTGAGGTCCTACCTCGTGGGACCG
-G--H--Q--A--W--I--V--G--I--V--E--K--G--N--R--T--A--R--I--I--D--K--P--R--V--I--E--V--L--P--R--G--T--

------------------------------------------------------->
T--A--A--V--L--A--P--D--S--S--N--A--S--S--E--P--S--S--*-
CAGCTGCTGTTCTTGCTCCTGACAGTTCAAATGCCTCCTCTGAGCCTAGCTCGTGA
: :::.:::.:::::::::::: :.::: :.::::::::::::::::::::.::::
CTGCTACTGCTCTTGCTCCTGAGAATTCCAGTGCCTCCTCTGAGCCTAGCTTGTGA
A--A--T--A--L--A--P--E--N--S--S--A--S--S--E--P--S--L--*-

Pig Consensus Sequence

>BGISUST0000894218
ATGGCGGAAGCCGCGGCGACGGGCGCCGGCGGAGAGATGATGGCGGCGGTGGCGGCGGGTGAAGGCTGCTCGGGCCCGGCGGGCTTGTCTCTAGGTCGGG
GCTTCTCGGGCTACCGGCCCTTCGAGCCCCAGGCGTTGGGCCTGAGCCCGAGCTGGCGGCTGACTGGCTTCTCTGGCATGAAGGGCTGAGGCTGCAAAGT
CCCCCAGGAGACGCTGCTCAAACTCCTGGCGGGACTGACGCGGCCGGAGGTGCGGCCCCCCGTGGGCCGGGGCCTGGTCGGAGGCCTTGAAGAGGCGGCC
CAGGAAGCCGGCCTGCCGGTGAGGGCGGAACCCAGCCCAACCTTCCCAACCCTCGGCATTGGCCTGGACTCCTGCGTCATCCCCCTGAGGCACGGGGGCC
TGTCCCTTGTGCAGACCACGGACTTTTTCTACCCCTTGGTGGAAGATCCCTACATGATGGGGCGCATAGCTTGTGCCAACGTGCTGAGTGACCTCTACGC
CATGGGCATTACTGAGTGTGACAACATGTTGATGCTCCTCAGCGTCAGCCAGAATATGATTGAGGAGGAACGAGAGAAAATAACCCCCCTCATGATCAAA
GGCTTTCGGGATGCCGCGGAGGAAGGAGGGACTGCAGTGACTGGCGGGCAGACGGTGATAAACCCTTGGATTATCATCGGCGGAGTGGCCACTGTGGTCT
GTCAGCCAAATGAATTCATTATGCCCGACAGTGCCGTTGTTGGGGATGTGCTGGTGTTAACCAAACCCCTAGGAACCCAAGTCGCCGTCAATGCCCACCA
ATGGCTGGATAATCCTGAAAGATGGAATAAGATAAAGATGGTCGTCTCAAGAGAAGAGGTAGAGCTGGCCTATCAGGAAGCCATGTTCAACATGGCTACT
CTAAATAGAACCGCTGCTGGCTTGATGCACACGTTTAATGCCCACGCAGCCACAGATATCACGGGCTTTGGCATTCTGGGACACTCGCAGAACCTTGCAA
AACAACAGAGAAATGAGGTGTCCTTTGTCATTCATAATCTGCCGATCATCGCCAAGATGGCTGCCATCAGCAAGGCCAGCGGCCGCTTTGGGCTCCTTCA
GGGAACCTCCGCAGAAACTTCTGGGGGGTTACTGATTTGTCTGCCAAGGGAGCAAGCAGCTCGCTTTTGTTCAGAAATCAAATCTTCAAAGTACGGAGAG
GGTCACCAAGCCTGGATCGTGGGCATTGTGGAAAAGGGAAACCGGACAGCCCGGATCATTGACAAGCCTCGAGTTATTGAGGTCCTACCTCGTGGGACCG
CTGCTACTGCTCTTGCTCCTGAGAATTCCAGTGCCTCCTCTGAGCCT


>BGISUSP0000894218
MAEAAATGAGGEMMAAVAAGEGCSGPAGLSLGRGFSGYRPFEPQALGLSPSWRLTGFSGMKG*GCKVPQETLLKLLAGLTRPEVRPPVGRGLVGGLEEAA
QEAGLPVRAEPSPTFPTLGIGLDSCVIPLRHGGLSLVQTTDFFYPLVEDPYMMGRIACANVLSDLYAMGITECDNMLMLLSVSQNMIEEEREKITPLMIK
GFRDAAEEGGTAVTGGQTVINPWIIIGGVATVVCQPNEFIMPDSAVVGDVLVLTKPLGTQVAVNAHQWLDNPERWNKIKMVVSREEVELAYQEAMFNMAT
LNRTAAGLMHTFNAHAATDITGFGILGHSQNLAKQQRNEVSFVIHNLPIIAKMAAISKASGRFGLLQGTSAETSGGLLICLPREQAARFCSEIKSSKYGE
GHQAWIVGIVEKGNRTARIIDKPRVIEVLPRGTAATALAPENSSASSEP